BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A11 (575 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 25 0.54 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 25 0.54 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 25 0.54 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 25 0.54 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 25 0.54 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 24 0.94 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 0.94 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 0.94 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 0.94 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 0.94 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 0.94 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 0.94 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 0.94 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 0.94 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 0.94 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 0.94 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 0.94 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 1.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 1.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.2 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 1.6 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 1.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 1.6 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 2.2 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 2.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 3.8 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 3.8 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 3.8 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 3.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 3.8 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 5.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 5.0 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 5.0 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 5.0 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 5.0 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 5.0 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 5.0 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 5.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 5.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 5.0 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 5.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.0 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 6.6 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 6.6 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 21 8.7 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 8.7 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 8.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.7 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 25.0 bits (52), Expect = 0.54 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R REKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYREKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSY 56 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 25.0 bits (52), Expect = 0.54 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R REKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYREKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSY 56 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 25.0 bits (52), Expect = 0.54 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R REKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYREKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSY 56 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 25.0 bits (52), Expect = 0.54 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R REKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYREKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSY 56 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 25.0 bits (52), Expect = 0.54 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R REKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 239 RDRNREYREKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREKKSYKNENSY 289 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 56 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 56 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 239 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 289 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R R+KD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 228 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 278 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R R+KD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 239 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 289 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R R+KD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 239 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 289 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 0.94 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R R+KD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 228 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 278 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 24.2 bits (50), Expect = 0.94 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 140 REKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 RE + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 243 REYKKKDRRYEKLHNEKKKLLEERTSRKRYSRSREREQKSYKNENSY 289 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/36 (30%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 254 KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 289 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/36 (30%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 259 KLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSY 294 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.8 bits (49), Expect = 1.2 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + ++SY Sbjct: 239 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSCSREREQKSYKNENSY 289 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + ++++N SRE+ Sbjct: 20 KLHNEKEKLLEERTNRKRNSRSRER 44 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + ++++N SRE+ Sbjct: 20 KLHNEKEKLLEERTNRKRNSRSRER 44 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 ++ N+K +LL + S+E+ SRE+ K + + Y Sbjct: 254 KLHNEKEKLLEERTSRERYSRSREREQKSYKNEREY 289 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 2.2 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R R+KD + ++ N+K +LL + S+++ SRE+ + + ++SY Sbjct: 239 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSREREQRSYKNENSY 289 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 467 FTPSVMNKKKKLFSFDLWD*TP 532 F+ NKK +F ++WD TP Sbjct: 546 FSLKFKNKKLPVFLAEIWDVTP 567 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 130 VQSKRKGHERETHRSDGEQENETSHSQK 213 +Q K E + D E +NE SQK Sbjct: 75 IQQAGKPKEETDDKDDDESDNENIKSQK 102 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + + Y Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREY 56 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + + Y Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREY 56 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R +EKD + ++ N+K +LL + S+++ SRE+ K + + Y Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNERKY 56 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 R R R+KD + ++ N+K +LL + S+++ SRE+ K + + Y Sbjct: 228 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSREREQKSYKNEREY 278 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R R+KD + ++ N+K +LL + S+++ SRE+ Sbjct: 6 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSRER 45 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 228 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 267 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R R+KD + ++ N+K +LL + S+++ SRE+ Sbjct: 228 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSRER 267 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R R+KD + ++ N+K +LL + S+++ SRE+ Sbjct: 239 RDRNREYRKKDRQYE---KLHNEKEKLLEERTSRKRYSRSRER 278 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 119 RVRPFNQREKDMSAKLIVQMENKKTRLLTVKNSKEQNDGSREK 247 R R +EKD + ++ N+K +LL + S+++ SRE+ Sbjct: 239 RDRNREYKEKDRRYE---KLHNEKEKLLEERTSRKRYSRSRER 278 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+++ SRE+ Sbjct: 21 KLHNEKEKLLEERTSRKRYSRSRER 45 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 281 SFDNDDAHYASQEQVFADLGLDVIDSAFE 367 SF++ A +Q++AD ++ +AFE Sbjct: 536 SFNDLLTQVAELDQIYADTHAKLVQAAFE 564 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 382 RLRIRTDRQREDVYYDGDL 438 R+ D+Q+ED + DG++ Sbjct: 34 RIETSIDQQKEDDFRDGNI 52 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+ + SRE+ Sbjct: 21 KLHNEKEKLLEERTSRNRYSRSRER 45 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+ + SRE+ Sbjct: 21 KLHNEKEKLLEERTSRNRYSRSRER 45 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+ + SRE+ Sbjct: 21 KLHNEKEKLLEERTSRNRYSRSRER 45 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+ + SRE+ Sbjct: 21 KLHNEKEKLLEERTSRNRYSRSRER 45 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+ + SRE+ Sbjct: 21 KLHNEKEKLLEERTSRNRYSRSRER 45 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+ + SRE+ Sbjct: 21 KLHNEKEKLLEERTSRNRYSRSRER 45 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK 247 ++ N+K +LL + S+ + SRE+ Sbjct: 21 KLHNEKEKLLEERTSRNRYSRSRER 45 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/36 (27%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 173 QMENKKTRLLTVKNSKEQNDGSREK-YKDFTFDHSY 277 ++ N+K +LL + S+++ SRE+ K + + Y Sbjct: 21 KLYNEKEKLLEERTSRKRYSRSREREQKSYKNERKY 56 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +2 Query: 470 TPSVMNKKKKLFSFDLW 520 TP+ +++++ FSF W Sbjct: 496 TPTTESEERRFFSFHQW 512 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,473 Number of Sequences: 438 Number of extensions: 3603 Number of successful extensions: 67 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -