BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A08 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_52568| Best HMM Match : 7tm_1 (HMM E-Value=1e-07) 29 3.3 SB_17029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 >SB_57508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1215 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -1 Query: 399 NILSMLKYHNFDPVLCSSIINSPAL*NVYXXXXKLFKCYVALISYES 259 ++L+ KYH+F PVL + I N A V+ ++K Y+A +S Sbjct: 642 SLLADKKYHHFRPVLEAYIDNHFAATIVHSTLIAVYKEYIAYAERDS 688 >SB_52568| Best HMM Match : 7tm_1 (HMM E-Value=1e-07) Length = 323 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +1 Query: 397 ISNYICMCVNL*ILCFLYCIYAIYIQIVHGNTFNDLSSNNFVLFSIFV 540 IS Y+ + +NL ++ + + Y IVHG ++ + N LFS+FV Sbjct: 38 ISFYV-LFMNLTVVSLVVLMLDRYGAIVHGLRYHSWKTRNKALFSVFV 84 >SB_17029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 354 KVLDQSCDILTLIVYFELYMHVCKFINTVFSILH 455 +VL Q+ D+LT FEL+++ K NT+ + + Sbjct: 238 EVLSQASDLLTKKELFELFLYFAKEDNTILELFN 271 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,324,927 Number of Sequences: 59808 Number of extensions: 277475 Number of successful extensions: 565 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -