BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A08 (552 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-3385|AAN11116.1| 381|Drosophila melanogaster CG31622-P... 30 2.4 AE014298-3064|AAF50873.1| 1223|Drosophila melanogaster CG12092-P... 29 5.5 >AE014134-3385|AAN11116.1| 381|Drosophila melanogaster CG31622-PD, isoform D protein. Length = 381 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +3 Query: 366 QSCDILTLIVYFELYMHVCKFINTVFSILHICNI 467 +SC I+T+++Y +LY+ +F+ + SIL I Sbjct: 86 RSCSIVTMLIYTQLYIQRFRFVALLQSILRFNQI 119 >AE014298-3064|AAF50873.1| 1223|Drosophila melanogaster CG12092-PA protein. Length = 1223 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 425 IYKYCVFYIAYMQYIS 472 I+ YCVFYI Y QY++ Sbjct: 1028 IFAYCVFYIYYEQYLT 1043 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,275,619 Number of Sequences: 53049 Number of extensions: 412221 Number of successful extensions: 1128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2110522698 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -