BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A08 (552 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 2.1 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 3.6 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 6.3 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 368 LIQYFAAPLLTPLPYKMFIRKKKNFLNAMWP 276 LI Y + L + +RKK+ F+ +WP Sbjct: 122 LIAYIYHLYMGLLSGGIILRKKREFMQKIWP 152 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 3.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 2 ARRESTRGASRYTIKPTTAAKAEEKQA 82 ARRE R A+ + PTT + A+ +A Sbjct: 502 ARREGIRLAAPFNASPTTWSPADLDRA 528 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 6.3 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 397 ISNYICMCVNL*ILCFLYCIYAIYIQIVHGNT 492 IS Y+ V L I C LYC +++ + T Sbjct: 199 ISFYVPCIVMLGIYCRLYCYAQKHVKSIRAVT 230 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,391 Number of Sequences: 438 Number of extensions: 3064 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -