BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A07 (578 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 26 0.31 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.9 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 3.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.8 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.8 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 8.8 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 25.8 bits (54), Expect = 0.31 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 511 RTPFHRCQS*SCKEYRSQAF*GSKFVVYAAQR 416 RTP S +CK+ + A GS+F +Y A + Sbjct: 569 RTPSVMSASSTCKKDKKNAGSGSRFTIYKANK 600 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = +3 Query: 24 NVTKTTGLHIGPKFVSVTQNVHNNEVVKDLPLPRYLW 134 N+T+ ++ G FV + N+++K R++W Sbjct: 47 NMTEKVHVNFGLAFVQLINVNEKNQIMKSNVWLRFIW 83 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 Query: 406 IICAAELRTLQTYFLRTLGYDIPYN 480 I+ E++ + TY ++ +D+ YN Sbjct: 249 ILAKKEIKGVPTYLIKWKNWDLKYN 273 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +2 Query: 173 VCRCSCSINHMCRSHCLLHY 232 +C S NH+ + H + HY Sbjct: 236 ICGKSFGYNHVLKLHQVAHY 255 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.0 bits (42), Expect = 8.8 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 143 EEFKQS*KIIVCRCSC 190 ++F+ + K I+C+C C Sbjct: 67 KDFRFAFKSIICKCFC 82 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 8.8 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 143 EEFKQS*KIIVCRCSC 190 ++F+ + K I+C+C C Sbjct: 515 KDFRFAFKSIICKCFC 530 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +1 Query: 367 IVQHTVSQECDRFIICAAELRTLQTYF 447 +VQH E + +C A ++ +F Sbjct: 180 VVQHQSGSEAEAEFVCIATPEAIELHF 206 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,691 Number of Sequences: 438 Number of extensions: 4029 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -