BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A01 (262 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 3.2 AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preprop... 22 4.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 21 5.6 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 21 7.3 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 21 7.3 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 21 7.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 21 7.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 21 7.3 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 21 7.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 21 7.3 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 21 7.3 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 21 7.3 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 21 7.3 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 21 7.3 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 21 7.3 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 21 7.3 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 21 7.3 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 21 7.3 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 21 7.3 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 21 7.3 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 21 7.3 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 21 7.3 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 21 9.7 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 21 9.7 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 21 9.7 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 21 9.7 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 256 GMIEIDERRSSAYGFII 206 G+++ DER +SAY F + Sbjct: 680 GLMDCDERFTSAYQFAV 696 >AY341429-1|AAR03495.1| 193|Anopheles gambiae sulfakinin preproprotein protein. Length = 193 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 256 GMIEIDERRSSAYGFIISART 194 G+ E D+ R S GF+ ART Sbjct: 118 GVDEQDQMRFSLEGFLTGART 138 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 21.4 bits (43), Expect = 5.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = +3 Query: 39 WLPQTECTWSIITLI 83 WL + CTW + L+ Sbjct: 805 WLMKVACTWDDVKLL 819 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 164 PDPFFSQPSNGPSGNYEPI 220 P P P GP+G+ P+ Sbjct: 595 PSPLAGGPLGGPAGSRPPL 613 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 21.0 bits (42), Expect = 7.3 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 116 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 232 S + +D N +V D Q N P+ + PIS+ P Sbjct: 102 STLGADSNFGSLVNGAVDTCARQIQNDPAYSVAPISSSP 140 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 21.0 bits (42), Expect = 7.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 97 GSRGGQ*WCSIGRQ 138 G GGQ CSI RQ Sbjct: 504 GGAGGQHACSIARQ 517 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 110 PPREPGLDYN 81 PP PGLDY+ Sbjct: 2493 PPCSPGLDYD 2502 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/24 (33%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = -1 Query: 70 IDH-VHSVCGSHGQYGEEEKHESF 2 I H + +CG + +EK E+F Sbjct: 2733 ISHGLEQICGGSADFPSQEKAENF 2756 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 64 HVHSVCGSHGQYGEEEKHES 5 HVH + HG Y + H + Sbjct: 43 HVHMMPEMHGAYSQVHHHRA 62 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 21.0 bits (42), Expect = 7.3 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 64 HVHSVCGSHGQYGEEEKHES 5 HVH + HG Y + H + Sbjct: 43 HVHMMPEMHGAYSQVHHHRA 62 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 186 HYSAPIAHHAAP 197 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 196 HYAAPIAHHAAP 207 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 182 HYSAPIAHHAAP 193 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 194 HYSAPIAHHAAP 205 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 194 HYSAPIAHHAAP 205 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 232 HYAAPIAHHAAP 243 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 218 HYSAPIAHHAAP 229 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 186 HYSAPIAHHAAP 197 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 194 HYSAPIAHHAAP 205 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 7.3 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 Query: 143 HYCRPMEHHYCP 108 HY P+ HH P Sbjct: 186 HYSAPIAHHAAP 197 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 20.6 bits (41), Expect = 9.7 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = -3 Query: 143 HYCRPMEHHY 114 +YCR + HH+ Sbjct: 167 YYCRNISHHF 176 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 20.6 bits (41), Expect = 9.7 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = +3 Query: 81 IIIQARFTWWTIVV 122 I+I+ ++WWT+ + Sbjct: 37 ILIRKVYSWWTLAM 50 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 20.6 bits (41), Expect = 9.7 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = +3 Query: 81 IIIQARFTWWTIVV 122 I+I+ ++WWT+ + Sbjct: 37 ILIRKVYSWWTLAM 50 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +3 Query: 21 SSPYWPWLPQTECT 62 S P+WP+L + C+ Sbjct: 49 SPPHWPYLLCSSCS 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 308,632 Number of Sequences: 2352 Number of extensions: 6907 Number of successful extensions: 38 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 13983072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -