BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P23 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 25 1.6 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.8 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 23 8.4 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -3 Query: 175 LFILIYRIHFYKRLTAPTNLSVPGKCPAYPPPLEWTLL 62 +F Y H++ R T T + P Y PP ++L+ Sbjct: 353 IFFPTYWPHYWNRFTQSTAMHNQPPPPPYQPPQPYSLM 390 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 4.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 55 EHSVASTLRGGGKPG 99 E+S + L GGGKPG Sbjct: 1110 EYSSSDQLMGGGKPG 1124 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 73 WTLLNVLKRTCGRNNRY 23 W + VL R C RN +Y Sbjct: 18 WPIATVLNRECVRNYQY 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 522,924 Number of Sequences: 2352 Number of extensions: 10696 Number of successful extensions: 99 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -