BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P21 (463 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.81 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 1.9 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 5.7 SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) 27 7.6 SB_20479| Best HMM Match : Collagen (HMM E-Value=1) 27 7.6 SB_33902| Best HMM Match : Metallothionein (HMM E-Value=0.71) 27 10.0 SB_16212| Best HMM Match : Apyrase (HMM E-Value=0) 27 10.0 SB_15169| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 27 10.0 SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) 27 10.0 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 30.3 bits (65), Expect = 0.81 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = +2 Query: 98 TGYYPLMT-SYYFPF--AQRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKK 268 T Y P T S Y Q+P+N++LH +A+ T L GKF+S G+ Sbjct: 4715 TSYQPAATDSLYISSQSTQKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRT 4770 Query: 269 IDFHD 283 D H+ Sbjct: 4771 RDVHE 4775 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 290 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 159 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +2 Query: 233 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 364 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 248 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 388 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 >SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37) Length = 1632 Score = 27.1 bits (57), Expect = 7.6 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +3 Query: 213 KRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAM 392 K + YS K ++ AR S ++ + + + KR KKK++R N MKL+ + Sbjct: 893 KFVDYSEKAKLRASAQARNSRSPVEVAIEEEKRVAKRKKEQRKKKVRRRKNAAMKLANKL 952 Query: 393 CS 398 S Sbjct: 953 VS 954 >SB_20479| Best HMM Match : Collagen (HMM E-Value=1) Length = 1214 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 230 SLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQR 367 +LQ+G S K+++ A+ G+ Q++ ++ E E +DYQR Sbjct: 499 NLQRGYIASNQDKLEWKVFFAMGKTGDNSQDSRNIREAEEQRDYQR 544 >SB_33902| Best HMM Match : Metallothionein (HMM E-Value=0.71) Length = 361 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 436 HEGVLVEWFRCCTEHMASDNFIRSLIILC 350 H+GV++ T H +DNFI I+C Sbjct: 93 HQGVVISRDDISTSHEEADNFIVQQAIMC 121 >SB_16212| Best HMM Match : Apyrase (HMM E-Value=0) Length = 372 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +1 Query: 157 LQSTQRKELRSNTVLGHF*KDFRTVPTERQIRIVWQE 267 L + NT HF + + TV +R I I W E Sbjct: 84 LDENSKSSTMKNTWTSHFKRGYLTVHPDRTISIEWDE 120 >SB_15169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 26.6 bits (56), Expect = 10.0 Identities = 17/75 (22%), Positives = 37/75 (49%) Frame = +3 Query: 210 LKRLSYSPYRKANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLA 389 + + S S + N ++ K +T +E+ K+TP K++ +R+++DL++ Sbjct: 1 MDKTSASSNTTGDENENGSFCVAKGKCTVTYAES-AKKTP---KRRERRLVSDLIRADRK 56 Query: 390 MCSVQHLNHSTSTPS 434 + +H N TP+ Sbjct: 57 QANGKHKNGQKRTPT 71 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 26.6 bits (56), Expect = 10.0 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 4/104 (3%) Frame = +2 Query: 17 LTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQR-PDNYNLHSVKNYEAI 193 LTTR + + LG+ P YSP TG P + Y P + N N + A+ Sbjct: 700 LTTRQLLQVILLCLGTSPTSPQYSPASTG--PSPSPEYSPSSPNYTPNINTSAYSLVPAL 757 Query: 194 RFLDIFEKTFVQS---LQKGKFESYGKKIDFHDEKAINFVGNYW 316 L I+ K ++ ++ + E+ KIDF ++ + G W Sbjct: 758 TPL-IYPKDLTKAKKMTKQNRKENKSDKIDFLEQDPLPEGGWGW 800 >SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) Length = 1650 Score = 26.6 bits (56), Expect = 10.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 104 YYPLMTSYYFPFAQRPDNYN 163 Y PL T+ ++ + RP NYN Sbjct: 1560 YSPLSTAPFYDYGYRPQNYN 1579 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 26.6 bits (56), Expect = 10.0 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 151 RPLSEWEIV*SHQGIVTSLN 92 RPL +W IV ++QG + S+N Sbjct: 3254 RPLEDWPIVPTNQGTLVSVN 3273 >SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 26.6 bits (56), Expect = 10.0 Identities = 16/76 (21%), Positives = 38/76 (50%), Gaps = 2/76 (2%) Frame = +2 Query: 155 NYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAI--NFVGNYWQENA 328 +Y V++YE + +++++ +S ++ SY + + E++ ++ +Y + Sbjct: 192 SYKRSYVRSYER-SYKRSYKRSYKRSYKRSYKRSYKRSYERSYERSYKRSYKRSYERSYE 250 Query: 329 DLYEEEVTKDYQRSYE 376 YE + Y+RSYE Sbjct: 251 RSYERSYERSYERSYE 266 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,677,331 Number of Sequences: 59808 Number of extensions: 291405 Number of successful extensions: 873 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 945255773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -