BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P20 (584 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 2.2 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 3.9 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 8.9 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 21 8.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.9 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 379 LVVYSLLLIQKVFTGRVIMI*VTSKVAISKKAFLLM 486 +V YS+L+I ++I +T + +SK +M Sbjct: 41 IVFYSVLMIISAIGNTTVLILITCRKRVSKSRIHIM 76 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 294 CARVQNSLPYFPSEHHKSQIYFLHPRNF 211 CA ++ ++P FP ++FL P F Sbjct: 193 CAMLKENMPEFPLYQLSCILFFLIPMVF 220 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 246 YGAQRGNMGGNFERAHNMDGLA 311 YG QRG GG + G+A Sbjct: 896 YGMQRGQSGGQTWSNSQVQGVA 917 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 533 CVIACMR**RRLGLRVIKRN 474 C ++C+R R LG + I N Sbjct: 399 CAVSCLRELRNLGRKTIMVN 418 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 485 IKRNAFLEIATFEVTQIIITRPVN 414 ++RNA +EIA +T + + R N Sbjct: 244 LQRNAIVEIAGDALTGLTVLRTFN 267 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,525 Number of Sequences: 438 Number of extensions: 2744 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -