BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P19 (501 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16895.1 68416.m02160 expressed protein 31 0.33 At5g15230.1 68418.m01784 gibberellin-regulated protein 4 (GASA4)... 29 2.3 At2g35420.1 68415.m04341 zinc finger (C3HC4-type RING finger) fa... 27 5.4 At1g30640.1 68414.m03747 protein kinase, putative contains prote... 27 5.4 At3g27325.1 68416.m03415 expressed protein 27 9.4 >At3g16895.1 68416.m02160 expressed protein Length = 83 Score = 31.5 bits (68), Expect = 0.33 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 13/80 (16%) Frame = +3 Query: 69 SSLLLFVCITFLVI-VSSPQNGALAD--KLIG----SC-VWGAVNYTSD-CNAECKRRGY 221 S+ L C +++ VS P N LA ++ G +C + + +Y +D CN +C R G+ Sbjct: 3 STKTLVTCFLVIILAVSLPNNNVLASDARIEGFSFDNCNIRCSEDYWNDECNKDCLRAGF 62 Query: 222 -RGGHCGS---FANVNCWCE 269 +GG CGS V C C+ Sbjct: 63 QKGGQCGSPCIPCPVKCCCQ 82 >At5g15230.1 68418.m01784 gibberellin-regulated protein 4 (GASA4) / gibberellin-responsive protein 4 identical to SP|P46690 Gibberellin-regulated protein 4 precursor {Arabidopsis thaliana} Length = 106 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 5/74 (6%) Frame = +3 Query: 54 MVKNYSSLLLFVCITF-----LVIVSSPQNGALADKLIGSCVWGAVNYTSDCNAECKRRG 218 M K+Y ++ L I +V+ SS N + K G S+C+ CK+ Sbjct: 1 MAKSYGAIFLLTLIVLFMLQTMVMASSGSNVKWSQKRYGPGSLKRTQCPSECDRRCKKTQ 60 Query: 219 YRGGHCGSFANVNC 260 Y C +F N C Sbjct: 61 YHKA-CITFCNKCC 73 >At2g35420.1 68415.m04341 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 254 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 183 TSDCNAECKRRGYRGGHCGSF 245 T+D N + KRR Y+ G C SF Sbjct: 209 TTDANVKSKRRHYQTGSCVSF 229 >At1g30640.1 68414.m03747 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 562 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/42 (30%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -3 Query: 481 YIED--KIKQ*FAVSKKY*QFVIKSRISDSDILIENAMDIFK 362 YIE+ KI++ +K + +++ ++D+D+ +E+ MDI K Sbjct: 57 YIENHYKIQKKSLQERKERRSILEQNLADADVTVEDKMDILK 98 >At3g27325.1 68416.m03415 expressed protein Length = 1048 Score = 26.6 bits (56), Expect = 9.4 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -3 Query: 223 LYPRLLHSALQSEV*LTAPHTQLPISL 143 ++PRL SA+Q+ + L++PH P++L Sbjct: 234 VHPRLRKSAVQTILTLSSPHQSPPLAL 260 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,175,564 Number of Sequences: 28952 Number of extensions: 196967 Number of successful extensions: 433 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -