BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P17 (519 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41901-1|AAC50569.1| 338|Homo sapiens LAMP protein. 31 1.8 BC033803-1|AAH33803.1| 338|Homo sapiens limbic system-associate... 31 1.8 >U41901-1|AAC50569.1| 338|Homo sapiens LAMP protein. Length = 338 Score = 31.5 bits (68), Expect = 1.8 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +3 Query: 324 KRHQ-DYMI*SQVHKFNELKKTIATC--QTEIPPKNSQVILI-QLPDNISTISSAYVVH 488 KRH +Y + ++ K + + TC QT+ PK SQV LI Q+P IS ISS V+ Sbjct: 88 KRHSLEYSL--RIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVN 144 >BC033803-1|AAH33803.1| 338|Homo sapiens limbic system-associated membrane protein protein. Length = 338 Score = 31.5 bits (68), Expect = 1.8 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +3 Query: 324 KRHQ-DYMI*SQVHKFNELKKTIATC--QTEIPPKNSQVILI-QLPDNISTISSAYVVH 488 KRH +Y + ++ K + + TC QT+ PK SQV LI Q+P IS ISS V+ Sbjct: 88 KRHSLEYSL--RIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVN 144 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,672,770 Number of Sequences: 237096 Number of extensions: 1423631 Number of successful extensions: 2360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2360 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -