BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P13 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY169964-1|AAO11676.1| 513|Drosophila melanogaster NINAD protein. 29 3.7 AE014134-2900|AAN11179.1| 513|Drosophila melanogaster CG31783-P... 29 3.7 >AY169964-1|AAO11676.1| 513|Drosophila melanogaster NINAD protein. Length = 513 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -2 Query: 320 LDPLLNTCLFYPPLFFTCTRPKYNEAIQSAVFFATYFTGVMRNSHICFL 174 +D L FY PLF T +R + +EA+ S + A + R + + FL Sbjct: 414 IDILKGLPSFYAPLFTTASRAEIDEALASELRLALNLPAIGRYTGVGFL 462 >AE014134-2900|AAN11179.1| 513|Drosophila melanogaster CG31783-PA protein. Length = 513 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -2 Query: 320 LDPLLNTCLFYPPLFFTCTRPKYNEAIQSAVFFATYFTGVMRNSHICFL 174 +D L FY PLF T +R + +EA+ S + A + R + + FL Sbjct: 414 IDILKGLPSFYAPLFTTASRAEIDEALASELRLALNLPAIGRYTGVGFL 462 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,620,950 Number of Sequences: 53049 Number of extensions: 386914 Number of successful extensions: 984 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -