BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P10 (587 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 1.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.4 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 5.8 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.8 bits (49), Expect = 1.1 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +1 Query: 361 NAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTSYQYQQLSIPAY 540 +A+ DK + + A P IS + T+A+Q+ P LT YQ+ P Y Sbjct: 121 SALQRARADKTYRRSYTHAKPPYSYISLI---TMAIQNSPQKMLTLSEIYQFIMDLFPFY 177 Query: 541 NR 546 + Sbjct: 178 RQ 179 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 4.4 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 Query: 154 QERGPSVSCQNVSWYIHR 101 +E GP V C +W +R Sbjct: 633 KEEGPKVVCYMTNWAFYR 650 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 460 VALQSLPSPQLTADTSYQYQQLSIPAY 540 +A+++ P +LT + Y+Y + P Y Sbjct: 94 MAIRNSPEKRLTLNGIYEYIMRNFPYY 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,445 Number of Sequences: 336 Number of extensions: 3098 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -