BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_P08 (497 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563 32 0.22 10_07_0121 + 13078163-13078690,13078957-13078977 32 0.29 04_03_1022 - 21778315-21779007 31 0.39 01_06_0193 - 27359575-27361962 29 1.6 01_01_1121 + 8893177-8893199,8893260-8893287,8893656-8893730,889... 29 2.1 10_07_0086 - 12755485-12756540,12756994-12757283,12757391-12757643 29 2.7 06_02_0346 - 14837982-14838122,14838208-14838327,14838411-148385... 29 2.7 05_05_0360 - 24395993-24397540,24397626-24397730,24398731-24399111 29 2.7 05_05_0020 - 21560896-21561352,21563399-21563480,21564143-215642... 29 2.7 01_06_0678 - 31114259-31114321,31114508-31114552,31114644-311147... 29 2.7 04_03_0904 + 20717005-20718087 28 3.6 02_05_1159 + 34563779-34564715,34567232-34567399,34567508-34568688 28 3.6 02_05_1157 - 34533625-34533875,34535279-34536340,34536673-345368... 28 3.6 02_05_0958 + 33073302-33073442,33073839-33073913,33074382-330744... 28 3.6 01_02_0007 + 10132380-10133201 28 3.6 03_01_0389 + 3021849-3022136,3022237-3022753,3022835-3022988,302... 28 4.8 10_01_0318 + 3493913-3496976,3497064-3497392 27 6.3 04_04_1322 + 32640414-32642327 27 6.3 02_05_1177 + 34739359-34740304,34740401-34740568,34740672-34741852 27 6.3 11_08_0022 + 27733247-27733935,27735722-27735981,27736213-277364... 27 8.4 10_08_0026 - 14253680-14253894,14253981-14254109,14254704-142547... 27 8.4 04_04_0207 + 23602065-23604315,23604611-23605116 27 8.4 03_03_0156 + 14939355-14939435,14939559-14939624,14940331-149404... 27 8.4 01_06_0747 - 31645136-31646521,31647870-31648142,31649080-316491... 27 8.4 >05_07_0014 - 27046329-27046371,27059170-27060017,27060739-27061563 Length = 571 Score = 32.3 bits (70), Expect = 0.22 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = +1 Query: 28 QPNYPNPSQYEIMVMLPNGTITYQPRPD---PFYQPHKPNQPDHHITPNRTNDLSSVQG 195 +P Y P QY + N Y PRP P QP K + P + PN S QG Sbjct: 500 RPRYGQPMQYHQSLTQANRQPGYAPRPQINRPAPQPQK-HAPSGNTAPNSVTSFKSPQG 557 >10_07_0121 + 13078163-13078690,13078957-13078977 Length = 182 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/70 (24%), Positives = 28/70 (40%) Frame = +1 Query: 43 NPSQYEIMVMLPNGTITYQPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQ 222 +P+ Y + +LP I +P P P DHH + +D + GG Q Sbjct: 75 DPTWYMLEHLLPTAAIPPEPMTPKKSSPAPPPAVDHHHRLSPPHDAAGYNGGIQAQHENQ 134 Query: 223 RFPECSEPCI 252 P+ +P + Sbjct: 135 HHPQEPQPAL 144 >04_03_1022 - 21778315-21779007 Length = 230 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/61 (32%), Positives = 24/61 (39%) Frame = +1 Query: 19 PGNQPNYPNPSQYEIMVMLPNGTITYQPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGG 198 P Q Y +P Y P T P P P+ PH P+ HH P S+ GG Sbjct: 57 PAPQQWYDHPPNYH-----PPHTPAPAPAPGPYIPPHHPH---HHHPPTPAPAPSTTPGG 108 Query: 199 H 201 H Sbjct: 109 H 109 >01_06_0193 - 27359575-27361962 Length = 795 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Frame = +1 Query: 253 NGVC--TEGNQCVCNPGYSM---DLTDRRCKPRCAGGC 351 NG+C + G +C C PGY M + R C+P + C Sbjct: 291 NGICEYSPGLRCTCPPGYEMTDPENWSRGCRPTFSVSC 328 >01_01_1121 + 8893177-8893199,8893260-8893287,8893656-8893730, 8894748-8894813,8894917-8894959,8895102-8895150, 8895899-8895992,8896078-8896130,8896921-8897005, 8897242-8897344,8897421-8897513,8897985-8898051, 8898309-8898375,8898463-8898516,8898632-8898766 Length = 344 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 343 GGCPNGLCSGPNLCICNMGY 402 G CPN C G CIC++ Y Sbjct: 70 GQCPNKECKGKQGCICSISY 89 >10_07_0086 - 12755485-12756540,12756994-12757283,12757391-12757643 Length = 532 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = +1 Query: 43 NPSQYEIMVMLPNGTITYQPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGH 201 +P+ Y + +LP I +P P P P DHH + +D + H Sbjct: 364 DPTSYMLENLLPTAAIPPEPMMPPTSSPAPPPAVDHHHRLSPPHDAAGSNYNH 416 >06_02_0346 - 14837982-14838122,14838208-14838327,14838411-14838564, 14838793-14838866,14838962-14839095,14839207-14839326, 14843174-14843308,14843842-14843976,14844343-14845003, 14845103-14845264,14845348-14845510,14880834-14881021 Length = 728 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +1 Query: 64 MVMLPNGTITYQPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVN 207 ++ + G QP PDP QP +QPD+ P + Q H + Sbjct: 270 IISIIRGESRTQPPPDPQPQPASHSQPDNQHGPVASQTSEEAQDHHTH 317 >05_05_0360 - 24395993-24397540,24397626-24397730,24398731-24399111 Length = 677 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = +1 Query: 91 TYQPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQG-GHVNGQNTQRFPECSEPCINGVC 264 T P D F + + N D S + HV+ Q + P+ SEP +NG C Sbjct: 472 TVSPETDIFLEKPLNKYSNQLCDRNEEEDDSGWETVSHVDEQGSSNSPDGSEPSVNGFC 530 >05_05_0020 - 21560896-21561352,21563399-21563480,21564143-21564263, 21564424-21565074,21565206-21565338,21565677-21565728, 21566115-21566244,21567241-21567300,21567444-21567536, 21567795-21567919,21568263-21568353,21568828-21569127, 21569415-21570038 Length = 972 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/79 (22%), Positives = 32/79 (40%) Frame = +1 Query: 238 SEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKDTS 417 S P +NG + + C YS + + KP+C+ C C G + G D S Sbjct: 635 SVPAVNGYHSTQERTSCEFRYSGEDVEGAAKPQCS--CGENACEGDHNGSSMRGLDSDDS 692 Query: 418 VKGRAVCVKRIRRSLNYFL 474 + + ++ R + F+ Sbjct: 693 IGRKHHFRSKLSRKYHSFM 711 >01_06_0678 - 31114259-31114321,31114508-31114552,31114644-31114742, 31114827-31114872,31115026-31115102,31115385-31115432, 31120640-31120708,31120848-31120853,31120955-31121032, 31121246-31121344,31121427-31121489,31122642-31122713, 31122800-31122874,31122965-31123021,31123983-31124186, 31124317-31124394,31124485-31124547,31124646-31125284, 31125367-31125416,31125496-31125576,31125896-31125923 Length = 679 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +1 Query: 139 QPDHHITPNRTNDLSS-VQGGHVNGQNTQRFPECSEPCINGVCTEGNQCVCNPGYSMDLT 315 + + + +R ND+ + V V Q+T+R E + ++G GN + + Sbjct: 123 EKEEKVVVDRKNDIGAEVVDTEVEVQSTERSAEDAAIVVDGAADSGNSEGAAESSAPSVP 182 Query: 316 DRRCKP 333 D RC+P Sbjct: 183 DERCEP 188 >04_03_0904 + 20717005-20718087 Length = 360 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 3/54 (5%) Frame = +1 Query: 19 PGNQPNY-PNPSQYEIMVMLPNGTITYQPRPDPFYQPHKP--NQPDHHITPNRT 171 P P Y P P Y+ PN TY+P+P P P+ P +P TP T Sbjct: 236 PNPPPTYKPAPPTYKPQPK-PNPPPTYKPQPKPTPTPYTPPTYKPQPKPTPTPT 288 Score = 27.9 bits (59), Expect = 4.8 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 28 QPNYPNPSQYEIMVMLPNGTITYQPRPDPFYQPH-KPNQP 144 QP PNP PN TY+P P P Y+P KPN P Sbjct: 221 QPK-PNPPPTYKPQPKPNPPPTYKPAP-PTYKPQPKPNPP 258 >02_05_1159 + 34563779-34564715,34567232-34567399,34567508-34568688 Length = 761 Score = 28.3 bits (60), Expect = 3.6 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 11/69 (15%) Frame = +1 Query: 247 CINGVCTEGNQCVCNPGYS---------MDLT--DRRCKPRCAGGCPNGLCSGPNLCICN 393 CI+ + G +C C+ GY D+ +R K C G C N L G C+C Sbjct: 284 CIDSIDGPGYRCNCSQGYEGNPYLDGGCQDINECERPDKYACFGECTNTL--GSYSCMCP 341 Query: 394 MGYHKDTSV 420 G D S+ Sbjct: 342 RGARGDPSI 350 >02_05_1157 - 34533625-34533875,34535279-34536340,34536673-34536837, 34536993-34537941 Length = 808 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +1 Query: 244 PCINGVCTE---GNQCVCNPGYSMDLTDRRCKP 333 PC +GVCT G +C C G+S D C+P Sbjct: 328 PC-HGVCTNLLGGYKCDCPHGFSGDAIKNDCRP 359 >02_05_0958 + 33073302-33073442,33073839-33073913,33074382-33074497, 33076863-33076977,33077100-33077228,33078907-33078954, 33079343-33079469,33079634-33079789,33080031-33080287, 33080431-33080580,33080660-33080714,33080793-33081088, 33081252-33081335,33081869-33081941,33082164-33082291, 33082905-33083090,33083179-33083316,33083394-33083519, 33083705-33083965 Length = 886 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = -3 Query: 282 TLIAFRANSIDARFRTFRET----LCVLSVNMASLDRGQIVGAVGGYVMIWLVWFM 127 TL F N +D+ + E+ LC L+ M ++ IV A G + +VWFM Sbjct: 141 TLFYFVNNQVDSTYMFNLESQIPKLCQLAQEMGEKEKISIVHAAGLQALSSMVWFM 196 >01_02_0007 + 10132380-10133201 Length = 273 Score = 28.3 bits (60), Expect = 3.6 Identities = 22/69 (31%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = +1 Query: 16 LPGNQPNYPNPSQYEIMVMLPNGTITYQPRPDPFYQPHKPNQPDHHITP-NRTNDLSSVQ 192 LP PN P P PN P+PDP P QPD + P + N S Q Sbjct: 188 LPQPDPNNPQPLPQPD----PNAPPQPLPQPDPNSPPQPLPQPDPNTPPGQQINAKISSQ 243 Query: 193 GGHVNGQNT 219 + G T Sbjct: 244 PDSIGGART 252 >03_01_0389 + 3021849-3022136,3022237-3022753,3022835-3022988, 3023076-3023166,3024556-3024627,3026366-3026689 Length = 481 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/49 (26%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +1 Query: 7 GGQLPGNQPNYPNPSQYEIMVMLPNGTIT-YQPRPDPFYQPHKPNQPDH 150 GG+ G+ P + + + P +T P P PF P P P + Sbjct: 213 GGRRDGHGPGHQQRGHHPSYIRAPLAVVTAAPPPPPPFVNPATPQTPPY 261 >10_01_0318 + 3493913-3496976,3497064-3497392 Length = 1130 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 343 GGCPNGLCSGPNLCICNMGYHK 408 G P GLC+G L + ++GY++ Sbjct: 481 GAIPPGLCTGGQLAVLDLGYNQ 502 >04_04_1322 + 32640414-32642327 Length = 637 Score = 27.5 bits (58), Expect = 6.3 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 3/72 (4%) Frame = +1 Query: 247 CINGVCT---EGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKDTS 417 CI CT EGN +C G+ +RC G CP + G + C+ + G K S Sbjct: 386 CIFEGCTKGAEGNTLLCK-GHG---GGKRCLFEGGGVCPKSVHGGTSFCVAH-GGGKRCS 440 Query: 418 VKGRAVCVKRIR 453 V G C K R Sbjct: 441 VPG---CTKSAR 449 >02_05_1177 + 34739359-34740304,34740401-34740568,34740672-34741852 Length = 764 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +1 Query: 256 GVCTE---GNQCVCNPGYSMDLTDRR-CKPR 336 G CT + CVC PG S + TDR C+P+ Sbjct: 330 GDCTNMLGSHTCVCPPGTSGNWTDRNGCRPK 360 >11_08_0022 + 27733247-27733935,27735722-27735981,27736213-27736404, 27737695-27738686 Length = 710 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +1 Query: 229 PECSEP---CINGVCTEGNQCVCNPGY 300 P C P C+N +G C C+PGY Sbjct: 277 PACVSPNSYCVNTTNGQGYLCKCSPGY 303 >10_08_0026 - 14253680-14253894,14253981-14254109,14254704-14254769, 14254887-14255133 Length = 218 Score = 27.1 bits (57), Expect = 8.4 Identities = 21/67 (31%), Positives = 28/67 (41%) Frame = +1 Query: 226 FPECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYH 405 FP ++PC+ C G +CV G S C C+ G N CI N + Sbjct: 100 FP-LTDPCVAINCGSGGECVKEEGLSY-----HC--ACSPGFVNMFNLTMFPCIKNCAFG 151 Query: 406 KDTSVKG 426 KD S +G Sbjct: 152 KDCSAQG 158 >04_04_0207 + 23602065-23604315,23604611-23605116 Length = 918 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 334 RCAGGCPNGLCSGPNLCICNMGYHKDTSVKGRAVCVKRIRRSLNYFLS 477 R AGG P+ LC P + I N+ ++ G + R RR ++ LS Sbjct: 386 RLAGGLPDTLCDSPAMSIINV---SGNALSGAIPELTRCRRLVSLSLS 430 >03_03_0156 + 14939355-14939435,14939559-14939624,14940331-14940414, 14940796-14940875,14941313-14941358,14941456-14941566, 14942224-14942290,14942615-14942630,14942871-14942931, 14943015-14943145,14943243-14943360,14944053-14944176, 14944517-14944618,14944717-14944785,14946250-14946329 Length = 411 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 100 PRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFP 231 P PDPF HK + +H +R +L+S Q V GQ P Sbjct: 362 PEPDPFEPRHK--KRNHIPLMSRQTELASKQCSIVKGQKVLSSP 403 >01_06_0747 - 31645136-31646521,31647870-31648142,31649080-31649148, 31649486-31649614 Length = 618 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +1 Query: 19 PGNQPNYPNPSQYEIMVML-PNGTITYQPRPDPFYQPHKPNQPDHHITPNRTN 174 P QP N Q+ M P + T Q P P QP+ P + P ++N Sbjct: 353 PVQQPQLSNTQQFPPQPMQQPQLSNTQQFAPQPVQQPNAQQFPPPPVQPQQSN 405 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,020,530 Number of Sequences: 37544 Number of extensions: 400444 Number of successful extensions: 1273 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1255 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -