BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O16 (472 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 33 0.001 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 3.3 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 33.1 bits (72), Expect = 0.001 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 29 VQFFIHS*WRRTSPLTRVKMSQPYERSNKRQCESRARNVTRECLQQ 166 + FFI+ W++TS LT K+ Y + RQ +S T +C+ Q Sbjct: 18 ILFFIYLYWQQTSNLTTSKLLYTYRQPYPRQKKSHPPQWTWQCINQ 63 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 3.3 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 158 LQQTPVLLH-SNSPSTFTASKHSWTIKSISTSTQT 259 L P+ H PS FT+S H ++I + + ++ Sbjct: 347 LHHNPMSHHLKQEPSGFTSSNHPFSINRLLPTAES 381 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,769 Number of Sequences: 336 Number of extensions: 1699 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -