BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O16 (472 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF426157-1|ABO26400.1| 97|Anopheles gambiae unknown protein. 25 1.3 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 24 2.3 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 24 2.3 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 24 2.3 AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 24 2.3 >EF426157-1|ABO26400.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 25.0 bits (52), Expect = 1.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 130 RFALSLVRALVWLRHFHAR*GTCPSPLRMNEEL 32 +FA+ VRA++W++ P PLR+ + L Sbjct: 14 QFAILCVRAMIWIKRLR----YTPEPLRVEDAL 42 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.2 bits (50), Expect = 2.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 201 VDGELLCKRTGVCCKHS 151 VDGE+ C R V C S Sbjct: 635 VDGEIACTRANVTCPRS 651 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.2 bits (50), Expect = 2.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 201 VDGELLCKRTGVCCKHS 151 VDGE+ C R V C S Sbjct: 635 VDGEIACTRANVTCPRS 651 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 24.2 bits (50), Expect = 2.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 201 VDGELLCKRTGVCCKHS 151 VDGE+ C R V C S Sbjct: 613 VDGEIACTRANVTCPRS 629 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 24.2 bits (50), Expect = 2.3 Identities = 17/65 (26%), Positives = 30/65 (46%) Frame = -2 Query: 225 QECFEAVNVDGELLCKRTGVCCKHSLVTFLARDSHCRLFERSYGCDIFTRVKGLVRRHYE 46 ++C E++NVD E T CK F+ + LFE+ +++T+ G + + Sbjct: 126 KQCHESINVDSEFTRYVTKPVCKADAKAFI-NCVYGTLFEQC-PTNVWTQKDGCTQLKDK 183 Query: 45 *MKNC 31 K C Sbjct: 184 IKKGC 188 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 435,375 Number of Sequences: 2352 Number of extensions: 8064 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -