BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O16 (472 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.2 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 2.2 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 22 2.9 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 3.8 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 3.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 3.8 X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 21 5.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.7 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 6.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 2.2 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 182 HSNSPSTFTASKHSWTIKSISTSTQTARGSLAKRPTTLGS 301 +SN+ S + + S + S +++ + G +RP+T GS Sbjct: 17 YSNTCSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGS 56 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.6 bits (46), Expect = 2.2 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 182 HSNSPSTFTASKHSWTIKSISTSTQTARGSLAKRPTTLGS 301 +SN+ S + + S + S +++ + G +RP+T GS Sbjct: 17 YSNTCSNSQSQRSSGSSISRNSNRSESSGYCGRRPSTFGS 56 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +2 Query: 92 QPYERSNKRQCESRARNVTRECLQQTPV 175 +P + + Q E A+N+ + CLQ+ + Sbjct: 19 KPVKSMSADQVEKLAKNMRKSCLQKIAI 46 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 188 NSPSTFTASKHSWTIKSISTSTQ 256 NSP +FTA HS + S S S Q Sbjct: 69 NSPGSFTAGCHS-NLLSTSPSGQ 90 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 188 NSPSTFTASKHSWTIKSISTSTQ 256 NSP +FTA HS + S S S Q Sbjct: 69 NSPGSFTAGCHS-NLLSTSPSGQ 90 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 88 VAAIRALEQATMRIAREKRYQGV 156 V A+RA+++ M + R Y GV Sbjct: 1049 VEAVRAVQRGEMSVHRAGSYYGV 1071 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 21.4 bits (43), Expect = 5.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 186 ATRHRHSRLRSTLGLSNQSVRRLKRR 263 A RHR + G++ ++RRL RR Sbjct: 16 AKRHRKVLGDNIQGITKPAIRRLARR 41 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 6.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 256 NGERIFGKASDDVRVIV 306 +GER+ KAS+D R V Sbjct: 1578 DGERVMLKASEDYRYSV 1594 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.0 bits (42), Expect = 6.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -1 Query: 55 PLRMNEELYPC 23 P NEE YPC Sbjct: 221 PASRNEEYYPC 231 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,495 Number of Sequences: 438 Number of extensions: 2214 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -