BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O15 (302 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 62 9e-11 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 62 9e-11 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 60 3e-10 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 58 9e-10 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 38 0.002 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 36 0.005 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 35 0.009 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 35 0.009 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 35 0.009 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 33 0.028 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 33 0.028 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 33 0.028 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 33 0.037 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 33 0.048 At1g32790.1 68414.m04042 RNA-binding protein, putative similar t... 32 0.085 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 0.11 At4g10610.1 68417.m01735 RNA-binding protein, putative 31 0.11 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 31 0.11 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 31 0.15 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 30 0.26 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 0.34 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 0.34 At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-bindi... 30 0.34 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 29 0.45 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 29 0.45 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 29 0.45 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 29 0.45 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 29 0.45 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 29 0.79 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 29 0.79 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 1.0 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 28 1.0 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 28 1.0 At1g53650.1 68414.m06105 RNA-binding protein, putative similar t... 28 1.0 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 28 1.4 At5g24440.1 68418.m02880 RNA-binding protein, putative 27 1.8 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 27 1.8 At1g51960.1 68414.m05857 calmodulin-binding family protein conta... 27 1.8 At5g27300.1 68418.m03260 pentatricopeptide (PPR) repeat-containi... 27 2.4 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 27 2.4 At3g14450.1 68416.m01831 RNA-binding protein, putative contains ... 27 2.4 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 27 2.4 At5g16270.1 68418.m01900 Rad21/Rec8-like family protein weak sim... 27 3.2 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 27 3.2 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 26 4.2 At2g27800.1 68415.m03370 pentatricopeptide (PPR) repeat-containi... 26 4.2 At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein... 26 5.6 At4g30300.1 68417.m04306 ABC transporter family protein ribonucl... 25 7.4 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 25 7.4 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 25 9.7 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 25 9.7 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 25 9.7 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 61.7 bits (143), Expect = 9e-11 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGI 136 G PKGFAY+EF + ++VQ A+ ++ES GRQ+KV PKRTN PG+ Sbjct: 126 GQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGM 170 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 61.7 bits (143), Expect = 9e-11 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGI 136 G PKGFAY+EF + ++VQ A+ ++ES GRQ+KV PKRTN PG+ Sbjct: 126 GQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGM 170 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 60.1 bits (139), Expect = 3e-10 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGI 136 G PKGFAY+EF + ++VQ A+ ++ES GRQ+KV+ KRTN PG+ Sbjct: 129 GQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVLQKRTNVPGL 173 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 58.4 bits (135), Expect = 9e-10 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGI 136 G PKGFAY+EF + ++VQ ++ ++ES GRQIKV KRTN PG+ Sbjct: 140 GQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGM 184 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 37.5 bits (83), Expect = 0.002 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +2 Query: 5 HPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKV 106 HPKG A++ F K+SV A+A+ ++F R IKV Sbjct: 484 HPKGTAFVTFATKESVGKAVALSGTMFYSRPIKV 517 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 35.9 bits (79), Expect = 0.005 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVM 109 G P G AYIEF K++ + A+++D + F R +K++ Sbjct: 554 GQPSGSAYIEFTRKEAAENALSLDGTSFMSRILKIV 589 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 35.1 bits (77), Expect = 0.009 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 5 HPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRP 154 H K FA++E + AM++D +F G +KV P +++T P Sbjct: 284 HEKKFAFVEMRSVEEASNAMSLDGIIFEGAPVKVRRPSDYNPSLAATLGP 333 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 35.1 bits (77), Expect = 0.009 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 5 HPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRP 154 H K FA++E + AM++D +F G +KV P +++T P Sbjct: 284 HEKKFAFVEMRSVEEASNAMSLDGIIFEGAPVKVRRPSDYNPSLAATLGP 333 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 35.1 bits (77), Expect = 0.009 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 5 HPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRP 154 H K FA++E + AM++D +F G +KV P +++T P Sbjct: 284 HEKKFAFVEMRSVEEASNAMSLDGIIFEGAPVKVRRPSDYNPSLAATLGP 333 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 33.5 bits (73), Expect = 0.028 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNR 151 +A++EF D SV+ A+ GRQ+ + +R N G+ R Sbjct: 301 YAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRGARR 345 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 33.5 bits (73), Expect = 0.028 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNR 151 +A++EF D SV+ A+ GRQ+ + +R N G+ R Sbjct: 360 YAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRGARR 404 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 33.5 bits (73), Expect = 0.028 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 2 GHPKGFAYIEFGDK-DSVQTAMAMDESLFRGRQIKVM 109 G P+GFA++EF D D+ + +M+ F GR+I V+ Sbjct: 85 GQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVV 121 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 33.1 bits (72), Expect = 0.037 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +2 Query: 5 HPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRP 154 H K FA++E + AMA+D + G +KV P +++T P Sbjct: 300 HEKKFAFVEMRSVEEASNAMALDGIILEGVPVKVRRPTDYNPSLAATLGP 349 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 32.7 bits (71), Expect = 0.048 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = +2 Query: 8 PKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKV---MPKRTNKPGISS 142 P+GF ++ F +DSV + G+Q++V +PK N PGI+S Sbjct: 150 PRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKDAN-PGIAS 196 >At1g32790.1 68414.m04042 RNA-binding protein, putative similar to RNA-binding protein GB:CAB40027 GI:4539439 from [Arabidopsis thaliana] Length = 358 Score = 31.9 bits (69), Expect = 0.085 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRP 154 FA+IEF D++ TA+ + ++ +KV+P +T ++ T P Sbjct: 214 FAFIEFTDEEGAMTALNLSGTMLGFYPVKVLPSKTAIAPVNPTFLP 259 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 31.5 bits (68), Expect = 0.11 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTN 148 G P+GF ++ + D SV + D + G+Q+++ KRT G S+N Sbjct: 80 GQPRGFGFVTYAD-SSVVDKVIQDNHIIIGKQVEI--KRTIPRGSMSSN 125 >At4g10610.1 68417.m01735 RNA-binding protein, putative Length = 336 Score = 31.5 bits (68), Expect = 0.11 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRP 154 FA+IEF D+ +TA+ + ++ +KVMP +T ++ T P Sbjct: 191 FAFIEFTDEVGARTALNLSGTMLGFYPVKVMPSKTAIAPVNPTFLP 236 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 31.5 bits (68), Expect = 0.11 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRPPR 160 G KG+ +IEF + Q A+ M+ L GR +++ N+ G + P R Sbjct: 421 GSFKGYGHIEFASPEEAQKALEMNGKLLLGRDVRL--DLANERGTPRNSNPGR 471 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 31.1 bits (67), Expect = 0.15 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 2 GHPKGFAYIEFGD-KDSVQTAMAMDESLFRGRQIKVMPKRTNK 127 G P+GF +I+F D D+ + MD L GR++ V+ N+ Sbjct: 75 GDPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFAEENR 117 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 30.3 bits (65), Expect = 0.26 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKV 106 G +GFA++ F + AM +D GR+I+V Sbjct: 72 GRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRV 106 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 29.9 bits (64), Expect = 0.34 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMA-MDESLFRGRQIKVMP 112 G +GF ++ F D+ + A++ MD GR I+V P Sbjct: 73 GRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNP 110 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 29.9 bits (64), Expect = 0.34 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMA-MDESLFRGRQIKVMP 112 G +GF ++ F D+ + A++ MD GR I+V P Sbjct: 73 GRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNP 110 >At3g49390.1 68416.m05399 RNA-binding protein, putative RNA-binding protein RBP37, Arabidopsis thaliana, PIR:T04196 Length = 353 Score = 29.9 bits (64), Expect = 0.34 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTNRP 154 FA+IEF +++ + A++M ++ +KV+P +T ++ T P Sbjct: 210 FAFIEFTNEEGARAALSMSGTVLGFYPLKVLPSKTAIAPVNPTFLP 255 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 29.5 bits (63), Expect = 0.45 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMP 112 G P G A++EF + + + AM D R I++ P Sbjct: 300 GRPTGEAFVEFRNAEDSRAAMVKDRKTLGSRYIELFP 336 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 29.5 bits (63), Expect = 0.45 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPG 133 G P+GF +I F D SV + D + G+Q+++ KRT G Sbjct: 57 GQPRGFGFITFAD-PSVVDKVIEDTHVINGKQVEI--KRTIPKG 97 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 29.5 bits (63), Expect = 0.45 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPG 133 G P+GF +I F D SV + D + G+Q+++ KRT G Sbjct: 57 GQPRGFGFITFAD-PSVVDKVIEDTHVINGKQVEI--KRTIPKG 97 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 29.5 bits (63), Expect = 0.45 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAM-AMDESLFRGRQIKVMPKRTNKPG 133 G KGF ++ F D+DS++TA+ M+ GR I + + G Sbjct: 82 GRSKGFRFVTFKDEDSMRTAIDRMNGQELDGRNITAQARGSGTRG 126 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 29.5 bits (63), Expect = 0.45 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 2 GHPKGFAYIEFGD-KDSVQTAMAMDESLFRGRQIKVMPKRTNK 127 G P+GF +++F D D+ MD L GR++ V+ N+ Sbjct: 74 GDPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFAEENR 116 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 28.7 bits (61), Expect = 0.79 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +2 Query: 8 PKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKV---MPKRTNKPG 133 P+GF ++ F +D+V + + G+Q++V +PK N G Sbjct: 150 PRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKDANPGG 194 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 28.7 bits (61), Expect = 0.79 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +2 Query: 8 PKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNKPGISSTN 148 P+GF ++ + +DSV+ M + ++++V + K GI S N Sbjct: 160 PRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEV-KRAIPKEGIQSNN 205 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 1.0 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 8 PKGFAYIEFGDKDSVQTAM-AMDESLFRGRQIKV 106 PKGF +I F +D Q A+ A++ + GR I V Sbjct: 106 PKGFGFITFESEDDAQKALKALNGKIVNGRLIFV 139 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = +2 Query: 11 KGFAYIEFGDKDSVQTAMA-MDESLFRGRQIKVMP---KRTNKPGISSTNRPPRT 163 +G AYI + + AM +D S F+GR + ++P + T+ ++ T+ P+T Sbjct: 302 RGIAYILYLIPECAARAMEELDNSSFQGRLLHILPAKHRETSDKQVNDTSNLPKT 356 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 28.3 bits (60), Expect = 1.0 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 8 PKGFAYIEFGDKDSVQTA-MAMDESLFRGRQI 100 PKGFAY+ F K+ + A + ++ L GR + Sbjct: 61 PKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At1g53650.1 68414.m06105 RNA-binding protein, putative similar to RNA-binding protein GB:AAA86641 GI:1174153 from [Arabidopsis thaliana] Length = 314 Score = 28.3 bits (60), Expect = 1.0 Identities = 9/35 (25%), Positives = 22/35 (62%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRT 121 FA++EF D ++A+++ ++ ++V+P +T Sbjct: 169 FAFVEFSDDQGARSALSLGGTMIGYYPVRVLPSKT 203 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMA-MDESLFRGRQIKV---MPKR 118 G KG+ ++ FGD++ AM M+ + RQ++V PKR Sbjct: 252 GRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKR 294 >At5g24440.1 68418.m02880 RNA-binding protein, putative Length = 320 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRT 121 FA+IEF D + ++A+ ++F I+V +T Sbjct: 178 FAFIEFTDAEGARSALRKSGTMFGSHPIRVFMSKT 212 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 27.5 bits (58), Expect = 1.8 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRTNK 127 G +GFA+IEF DS AM + G++I + +RT K Sbjct: 54 GESRGFAFIEFESADSAGRAMLHMDGRLIGQKI-LCVQRTPK 94 >At1g51960.1 68414.m05857 calmodulin-binding family protein contains IQ calmodulin-binding motif, Pfam:PF00612 Length = 351 Score = 27.5 bits (58), Expect = 1.8 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 154 ATYDARPRTRVPRRFLAILRRLPART-SRQVHPILDYSHY 270 AT+D R RT++ + +RR +R+ SRQVH ++ S Y Sbjct: 187 ATFDDR-RTKIVEKDDRYMRRSSSRSRSRQVHNVVSMSDY 225 >At5g27300.1 68418.m03260 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 510 Score = 27.1 bits (57), Expect = 2.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 178 TRVPRRFLAILRRLPARTSRQVHPILDYSHYSLSVSSLP 294 T VP R L RR+ +R PIL+ S + ++S LP Sbjct: 91 TSVPTRSLR--RRISSRKKSSTKPILNESKFQETISKLP 127 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 27.1 bits (57), Expect = 2.4 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 8 PKGFAYIEFGDKDSVQTAM-AMDESLFRGRQIKV 106 PKGF +I F +D + A+ ++D + GR I V Sbjct: 47 PKGFGFITFDSEDDARKALKSLDGKIVDGRLIFV 80 >At3g14450.1 68416.m01831 RNA-binding protein, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (2 copies) Length = 327 Score = 27.1 bits (57), Expect = 2.4 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +2 Query: 17 FAYIEFGDKDSVQTAMAMDESLFRGRQIKVMPKRT 121 FA++EF D A+++ ++ ++V+P +T Sbjct: 182 FAFVEFADDQGAHEALSLGGTMLGFYPVRVLPSKT 216 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 27.1 bits (57), Expect = 2.4 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESL-FRGRQIKV 106 G PKG+ + E+ D+++ +A +S GRQ++V Sbjct: 47 GKPKGYGFCEYKDEETALSARRNLQSYEINGRQLRV 82 >At5g16270.1 68418.m01900 Rad21/Rec8-like family protein weak similarity to cohesion family protein SYN2 [Arabidopsis thaliana] GI:12006360; contains Pfam profiles PF04824: Conserved region of Rad21 / Rec8 like protein, PF04825: N terminus of Rad21 / Rec8 like protein; supporting cDNA gi|18157648|gb|AF400129.1|AF400129 Length = 1031 Score = 26.6 bits (56), Expect = 3.2 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 32 FGDKDSVQTAMAMDESLFRGRQI 100 FGD D+ Q A+ +DE++F+ + + Sbjct: 164 FGDGDTSQAALDLDEAVFQDKDV 186 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQ 97 G KG+ ++ F D DS A+A + GR+ Sbjct: 55 GKSKGYGFVTFRDSDSATRAVADPNPVIDGRK 86 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMA-MDESLFRGRQIKV---MPKR 118 G KG+ ++ FGD++ A+ M+ + RQ++V PKR Sbjct: 241 GRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKR 283 >At2g27800.1 68415.m03370 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 427 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 169 RPRTRVPRRFLAILRRLPARTSRQVHPILDYSHYSLSVSSLP 294 R ++VP R L RR+ R PIL+ S + ++S LP Sbjct: 80 RTSSQVPTRSLR--RRISNRKKSSAKPILNVSKFHETISKLP 119 >At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to Heterogeneous nuclear ribonucleoprotein SP|P55795, SP|P31943, SP|P52597 {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 289 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKVMP 112 G G A++EF + + AMA D+ R +++ P Sbjct: 238 GKATGEAFVEFETGEEARRAMAKDKMSIGSRYVELFP 274 >At4g30300.1 68417.m04306 ABC transporter family protein ribonuclease L inhibitor - Mus musculus,PIR2:JC6555 Length = 181 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = +1 Query: 133 YIIDEPSATYDARPR---TRVPRRFLAILRR 216 Y+IDEPSA D+ R ++V +RF+ +++ Sbjct: 137 YLIDEPSAFLDSEQRIIASKVIKRFILQMKK 167 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 25.4 bits (53), Expect = 7.4 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQIKV 106 G +GF ++EF + Q A+ GR+I++ Sbjct: 335 GSFRGFGHVEFASSEEAQKALEFHGRPLLGREIRL 369 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 2 GHPKGFAYIEFG-DKDSVQTAMAMDESLFRGRQIKV 106 G PKGFA+++F KD+ + +F R I V Sbjct: 369 GLPKGFAFVKFTCKKDAANAIKKFNGHMFGKRPIAV 404 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQ 97 G KG+ ++ F + DS A+A + GR+ Sbjct: 55 GKSKGYGFVTFRESDSATRAVADPNPVIDGRK 86 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 2 GHPKGFAYIEFGDKDSVQTAMAMDESLFRGRQ 97 G KG+ ++ F + DS A+A + GR+ Sbjct: 55 GKSKGYGFVTFRESDSATRAVADPNPVIDGRK 86 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,729,706 Number of Sequences: 28952 Number of extensions: 94025 Number of successful extensions: 328 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 301317600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -