BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O14 (594 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0715 - 20352613-20352852,20352926-20352982,20354208-203543... 31 0.69 03_06_0660 - 35349264-35349375,35349914-35350017,35350211-353503... 29 2.1 04_03_0991 - 21500143-21500799,21500834-21501172 29 3.7 06_01_0912 - 7036420-7037503,7037599-7037819 28 4.9 03_05_0939 - 28983091-28983747,28983805-28983913,28984245-289848... 28 6.5 08_02_1400 + 26779193-26779245,26779622-26779766,26779950-267810... 27 8.5 >08_02_0715 - 20352613-20352852,20352926-20352982,20354208-20354339, 20354754-20354828,20355779-20355943,20356031-20356263, 20356484-20356574,20356789-20357223,20357911-20357976, 20358688-20358807,20358915-20359121 Length = 606 Score = 31.1 bits (67), Expect = 0.69 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 331 KRSLYGLQRWTSDEESIKKRKAISSYLDYQHGPFYRRYR 447 K + L +WT DEE K K + +Y D + P+Y R Sbjct: 531 KMITFALTQWTKDEEEAFKAKVVEAY-DKEGSPYYSTAR 568 >03_06_0660 - 35349264-35349375,35349914-35350017,35350211-35350368, 35350899-35350986,35352927-35353025,35353377-35353472, 35353591-35353628,35357960-35358285,35358600-35358796 Length = 405 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 427 PFYRRYRSALPKKLSMRSTQC*DYTHTYVSIGNTSISPRKLVKTMAVSYNIPVRCS 594 P RR+R A P++ TQC H+ + TS+ RK + +S + RC+ Sbjct: 83 PSQRRHREAQPRRSMGNPTQC-ARIHSRWRVHPTSLEARKANQDATMSGSTEARCA 137 >04_03_0991 - 21500143-21500799,21500834-21501172 Length = 331 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/65 (29%), Positives = 31/65 (47%) Frame = +3 Query: 387 TESHFVVSGLSAWAILSTLSFGAAEETFDEIHTVLRLHPHVCFNWKYFNISKEIGENDGG 566 ++ H + GL A + ++F + +TF VL V F + F SKE+G GG Sbjct: 160 SDLHRHLGGLLATGEGADVTFEVSGKTFAAHRLVLAARSPV-FRAELFGPSKELGATTGG 218 Query: 567 VLQHS 581 + H+ Sbjct: 219 AVDHT 223 >06_01_0912 - 7036420-7037503,7037599-7037819 Length = 434 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -3 Query: 577 CCKTPPSFSPISLEILKYFQLKHTCGCSLSTVWISSKVSSAAPND-SVDRMAHA 419 CC P + +L+YF T ++S+ + + S+AA D SV R A Sbjct: 42 CCSPPGGHQAVFSPLLQYFNGNGTYSSNISSSGVEERSSAAASCDYSVGRWVRA 95 >03_05_0939 - 28983091-28983747,28983805-28983913,28984245-28984801, 28985197-28985414,28985508-28985613,28986352-28986429 Length = 574 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 444 SFGAAEETFDEIHTVLRLHPHVCFNWKYFNIS 539 SFGA + FD+ V R+ FNW YF+I+ Sbjct: 189 SFGA--DQFDDTDPVERIQKGSFFNWFYFSIN 218 >08_02_1400 + 26779193-26779245,26779622-26779766,26779950-26781059, 26781153-26781404,26782150-26782230,26782623-26782770, 26782858-26783264,26783557-26783613 Length = 750 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 84 SEMYKCTSAFRLNRTAAVPKPSPRHMLSP 170 S +Y+C+S +N P PS R + SP Sbjct: 56 SRLYECSSTLPVNPAEEAPTPSSRPVSSP 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,192,113 Number of Sequences: 37544 Number of extensions: 289457 Number of successful extensions: 806 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -