BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O07 (504 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 29 2.9 SB_10759| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 327 KMSPVAILLMKYFICSICAS*CFYYFYIR 413 K+ PVAIL IC CA F+ FY R Sbjct: 14 KVGPVAILKRTRGICQSCAFKLFHRFYFR 42 >SB_10759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 260 EQTDANMDVNRLERTLSPV--NDC*NVASRYTAYEIFHLFNL 379 +QTDA R T PV ++C + Y + E++H FN+ Sbjct: 270 QQTDAGDTSTRTYETYHPVKCSECGTEVAVYDSDEVYHFFNI 311 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,826,077 Number of Sequences: 59808 Number of extensions: 238401 Number of successful extensions: 532 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -