BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O07 (504 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 5.5 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 7.3 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 7.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 7.3 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.6 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.6 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 491 LLVCYH*LFVKCKKRAFKYLLVRTNLTDIKV 399 +LVC V+ +R YLLV ++D+ V Sbjct: 60 ILVCVAVFLVRKLRRPCNYLLVSLAVSDLCV 90 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 94 NNNYDTRSLNNVIDTKQQSSP 32 NNNY+ + N+I+ +Q P Sbjct: 105 NNNYNKKLYYNIINIEQIPVP 125 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 94 NNNYDTRSLNNVIDTKQQSSP 32 NNNY+ + N+I+ +Q P Sbjct: 105 NNNYNKKLYYNIINIEQIPVP 125 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 94 NNNYDTRSLNNVIDTKQQSSP 32 NNNY+ + N+I+ +Q P Sbjct: 325 NNNYNKKLYYNIINIEQIPVP 345 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 396 YYFYIREVCSY 428 YY+Y+RE+ Y Sbjct: 233 YYYYMREMLPY 243 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +3 Query: 396 YYFYIREVCSY 428 YY+Y+RE+ Y Sbjct: 233 YYYYMREMLPY 243 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,375 Number of Sequences: 438 Number of extensions: 2545 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -