BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_O05 (550 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB007890-1|BAA24860.3| 1506|Homo sapiens KIAA0430 protein protein. 30 4.6 BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycop... 30 6.1 BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycop... 30 6.1 BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycop... 30 6.1 BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycop... 30 6.1 BC133019-1|AAI33020.1| 1427|Homo sapiens CCDC144A protein protein. 29 8.1 BC104815-1|AAI04816.1| 725|Homo sapiens coiled-coil domain cont... 29 8.1 BC101585-1|AAI01586.1| 725|Homo sapiens coiled-coil domain cont... 29 8.1 BC062767-1|AAH62767.1| 271|Homo sapiens CCDC144B protein protein. 29 8.1 BC036241-1|AAH36241.2| 226|Homo sapiens coiled-coil domain cont... 29 8.1 AK093811-1|BAC04228.1| 571|Homo sapiens protein ( Homo sapiens ... 29 8.1 >AB007890-1|BAA24860.3| 1506|Homo sapiens KIAA0430 protein protein. Length = 1506 Score = 30.3 bits (65), Expect = 4.6 Identities = 14/62 (22%), Positives = 28/62 (45%) Frame = +2 Query: 284 YEFSIFYQKLREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQFLYAYYIAVIQRNDT 463 Y +F EE + L L+ +AK+ + + + ++ L+E Y Y+ + T Sbjct: 1232 YLVEVFTNDKMEECVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKT 1291 Query: 464 HG 469 +G Sbjct: 1292 YG 1293 >BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 89 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 214 VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 34 VDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 89 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 214 VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 34 VDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 89 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 214 VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 34 VDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.9 bits (64), Expect = 6.1 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +2 Query: 89 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 214 VD E ++ S FQD + DD+YY G+ Y+ EAN D Sbjct: 34 VDRAQDEYTQRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC133019-1|AAI33020.1| 1427|Homo sapiens CCDC144A protein protein. Length = 1427 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 28 SLP-SCNPVWCPENVSLQDKRCRRS 99 SLP + NP W P N++L D+ C+RS Sbjct: 131 SLPQNNNPDWHPTNLTLSDETCQRS 155 >BC104815-1|AAI04816.1| 725|Homo sapiens coiled-coil domain containing 144B protein. Length = 725 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 28 SLP-SCNPVWCPENVSLQDKRCRRS 99 SLP + NP W P N++L D+ C+RS Sbjct: 131 SLPQNNNPDWHPTNLTLSDETCQRS 155 >BC101585-1|AAI01586.1| 725|Homo sapiens coiled-coil domain containing 144B protein. Length = 725 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 28 SLP-SCNPVWCPENVSLQDKRCRRS 99 SLP + NP W P N++L D+ C+RS Sbjct: 131 SLPQNNNPDWHPTNLTLSDETCQRS 155 >BC062767-1|AAH62767.1| 271|Homo sapiens CCDC144B protein protein. Length = 271 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 28 SLP-SCNPVWCPENVSLQDKRCRRS 99 SLP + NP W P N++L D+ C+RS Sbjct: 131 SLPQNNNPDWHPTNLTLSDETCQRS 155 >BC036241-1|AAH36241.2| 226|Homo sapiens coiled-coil domain containing 144C protein. Length = 226 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 28 SLP-SCNPVWCPENVSLQDKRCRRS 99 SLP + NP W P N++L D+ C+RS Sbjct: 131 SLPQNNNPDWHPTNLTLSDETCQRS 155 >AK093811-1|BAC04228.1| 571|Homo sapiens protein ( Homo sapiens cDNA FLJ36492 fis, clone THYMU2018455. ). Length = 571 Score = 29.5 bits (63), Expect = 8.1 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 28 SLP-SCNPVWCPENVSLQDKRCRRS 99 SLP + NP W P N++L D+ C+RS Sbjct: 131 SLPQNNNPDWHPTNLTLSDETCQRS 155 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,070,879 Number of Sequences: 237096 Number of extensions: 1600950 Number of successful extensions: 3202 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3202 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -