BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N22 (488 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058501-1|AAL13730.1| 1072|Drosophila melanogaster LD19406p pro... 30 2.0 AF247762-1|AAF74193.1| 1072|Drosophila melanogaster Netrin recep... 30 2.0 AE013599-2049|AAF58143.2| 1072|Drosophila melanogaster CG8166-PA... 30 2.0 >AY058501-1|AAL13730.1| 1072|Drosophila melanogaster LD19406p protein. Length = 1072 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 151 NTRHRIKYLFGENEFKMAINCSGFRKKHYDV 243 N HR YL GE+ M I C G + HYDV Sbjct: 577 NPGHR--YLPGEHIMGMGIGCGGVTEHHYDV 605 >AF247762-1|AAF74193.1| 1072|Drosophila melanogaster Netrin receptor DUnc5 protein. Length = 1072 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 151 NTRHRIKYLFGENEFKMAINCSGFRKKHYDV 243 N HR YL GE+ M I C G + HYDV Sbjct: 577 NPGHR--YLPGEHIMGMGIGCGGVTEHHYDV 605 >AE013599-2049|AAF58143.2| 1072|Drosophila melanogaster CG8166-PA protein. Length = 1072 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 151 NTRHRIKYLFGENEFKMAINCSGFRKKHYDV 243 N HR YL GE+ M I C G + HYDV Sbjct: 577 NPGHR--YLPGEHIMGMGIGCGGVTEHHYDV 605 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,319,671 Number of Sequences: 53049 Number of extensions: 542023 Number of successful extensions: 1261 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1261 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1726192251 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -