BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N19 (505 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.34 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 0.78 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 24 0.78 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 1.8 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 1.8 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 1.8 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 1.8 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 2.4 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 22 3.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.3 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 7.3 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.6 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.6 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 9.6 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.4 bits (53), Expect = 0.34 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 277 YYTPERNPKEADYTAPIYAPQN 342 Y+ E++PK+ T P APQN Sbjct: 302 YFRAEKDPKKMPCTQPPSAPQN 323 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 0.78 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 79 TTPVDDKESEHREGFTALV 135 T P+DD S+ EGF A++ Sbjct: 150 TNPLDDSISQANEGFCAVI 168 Score = 21.0 bits (42), Expect = 7.3 Identities = 17/75 (22%), Positives = 30/75 (40%), Gaps = 8/75 (10%) Frame = +1 Query: 100 ESEHREGFTALVREMKQALNVKPNMQLVISVLPNV-NSSIYFDV--PSIINLV-----DI 255 E +H+ F + + + P ++ SV N++ Y P ++ D+ Sbjct: 279 EQQHKAMFLVVTAQPVHSAYKAPEETIISSVFTTRHNATCYLSHVDPDVVQYFGYLPQDM 338 Query: 256 VNIQAFDYYTPERNP 300 V FD+Y PE P Sbjct: 339 VGRSLFDFYHPEDLP 353 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 24.2 bits (50), Expect = 0.78 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 79 TTPVDDKESEHREGFTALV 135 T P+DD S+ EGF A++ Sbjct: 145 TNPLDDSISQANEGFCAVI 163 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 373 INYWIQNGAPTHKLVLGISTTGRTWKLDSDSGNSGVPPI 489 +++WI + A + ++ LGI TT T S S +P I Sbjct: 261 VSFWINHEATSARVALGI-TTVLTMTTISTGVRSSLPRI 298 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 373 INYWIQNGAPTHKLVLGISTTGRTWKLDSDSGNSGVPPI 489 +++W+ A ++ LG+ TT T S N+ +P I Sbjct: 240 VSFWLNRNATPARVALGV-TTVLTMTTLMSSTNAALPKI 277 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 373 INYWIQNGAPTHKLVLGISTTGRTWKLDSDSGNSGVPPI 489 +++W+ A ++ LG+ TT T S N+ +P I Sbjct: 240 VSFWLNRNATPARVALGV-TTVLTMTTLMSSTNAALPKI 277 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 373 INYWIQNGAPTHKLVLGISTTGRTWKLDSDSGNSGVPPI 489 +++W+ A ++ LG+ TT T S N+ +P I Sbjct: 179 VSFWLNRNATPARVALGV-TTVLTMTTLMSSTNAALPKI 216 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.6 bits (46), Expect = 2.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +1 Query: 373 INYWIQNGAPTHKLVLGIST--TGRTWKLDS 459 +++WI A + ++ LGI+T T T LDS Sbjct: 264 VSFWIHREATSDRVGLGITTVLTLSTISLDS 294 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 27 DSFEYWIFLAQHQENIRDYPC 89 DS E I L +EN R+Y C Sbjct: 50 DSSEARIKLINEEENFRNYGC 70 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 44 DLSGTASRKHSGLPLLM 94 D++G +KH PLLM Sbjct: 131 DIAGLRKKKHKVNPLLM 147 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 7.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 170 ICS*LSAFCQT*IAPFTLTS 229 IC+ L+A CQ + F +TS Sbjct: 644 ICTKLTADCQPGVTAFIVTS 663 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 7.3 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -1 Query: 367 RRRFVEDRGSAVRKSVQCSPPLWGYVQVY 281 R+ + EDR +R+ P + QVY Sbjct: 14 RQVYGEDRWEEIRRQASVEQPSFSVHQVY 42 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 20.6 bits (41), Expect = 9.6 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +1 Query: 373 INYWIQNGAPTHKLVLGISTTGRTWKLDSDSGNS 474 +++W+ A ++VLG +T L S NS Sbjct: 251 VSFWLHMDASPPRIVLGTNTILTFMTLASKVENS 284 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 9.6 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +1 Query: 373 INYWIQNGAPTHKLVLGIST 432 +++W+ A ++ LGI+T Sbjct: 233 VSFWLNREATADRVSLGITT 252 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 125 VKPSLCSDSLSSTGVVPNVFL 63 V ++CSD S GV+ ++ + Sbjct: 971 VNETVCSDYFSQGGVIESIMV 991 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 250 DIVNIQAFDYYTPERNP 300 D+V FD+Y PE P Sbjct: 43 DMVGRSLFDFYHPEDLP 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.314 0.133 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,983 Number of Sequences: 438 Number of extensions: 2814 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -