BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N16 (638 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI000038D794 Cluster: COG1216: Predicted glycosyltrans... 33 7.7 >UniRef50_UPI000038D794 Cluster: COG1216: Predicted glycosyltransferases; n=1; Nostoc punctiforme PCC 73102|Rep: COG1216: Predicted glycosyltransferases - Nostoc punctiforme PCC 73102 Length = 309 Score = 32.7 bits (71), Expect = 7.7 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 6/87 (6%) Frame = -3 Query: 354 SWCSVNNLPPSIVYIFSL*EDFQYKLTL-----HQSIN*WYILHNHIGKPPHVQTVTQTR 190 S + + P V +F D Y L L H I I+H++ G P V+ + + R Sbjct: 171 SLAAAKTISPPCVDLFIDGIDLDYGLRLRQKGFHNLIATKAIMHHNFGSPIQVKFMNKYR 230 Query: 189 FILYYS*LTFFFY-SEPTYLLTAFSIG 112 +I YS L +++ +YL T FS G Sbjct: 231 YIQQYSALRYYYICRNHSYLETRFSQG 257 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,938,324 Number of Sequences: 1657284 Number of extensions: 12136433 Number of successful extensions: 21123 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 20520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21109 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47711253245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -