BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N13 (643 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 31 0.59 11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 29 3.1 06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641... 28 7.2 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 31.5 bits (68), Expect = 0.59 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 387 TRVPLSL-VCT*MRDSSCTHIILQLSSAMILMDSFYQLLMKLST 515 T+ P S V T + S+CTH QLSSA +L + +K+ST Sbjct: 65 TQCPCSFAVATSISSSTCTHFTPQLSSAHLLSSQLKEKELKVST 108 >11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 Length = 921 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 7/79 (8%) Frame = +2 Query: 362 YAKDFETFYKSAAFARVHLNEGQFLYAYYIAVI-------QRNDTHGFVLPAPYEVIHNS 520 Y KD FY + + + EG+FL ++Y+ + + D + E+ H Sbjct: 697 YVKDSRLFYSFSESTKELVQEGEFLQSFYVQIAPSTVNIRKLEDEEDKLTSMLQELAHKR 756 Query: 521 SLIWTLYLRFIALKCKTVF 577 S +Y R IAL+ ++ Sbjct: 757 SPYGDVYHRCIALEFSVMY 775 >06_03_0499 + 21461608-21463427,21463517-21463627,21463867-21464143, 21464265-21464353,21464508-21464595,21464698-21464907, 21464985-21465110,21465429-21465620,21466532-21467188 Length = 1189 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 409 TSESGTLVEGFKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQF 263 +S +G + FK+ +++E K + L EDG++++ K DS+ F Sbjct: 599 SSSNGPVEREFKILNLLEFNSKRKRMSVILKDEDGQILLFCKGADSIIF 647 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,806,048 Number of Sequences: 37544 Number of extensions: 306200 Number of successful extensions: 650 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -