BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N13 (643 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41994-2|AAO38634.1| 154|Caenorhabditis elegans Rnase h protein... 32 0.40 U41994-1|AAO91711.1| 155|Caenorhabditis elegans Rnase h protein... 32 0.40 AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of e... 29 2.1 Z35663-8|CAA84728.1| 249|Caenorhabditis elegans Hypothetical pr... 29 3.7 AL132865-13|CAB60609.1| 496|Caenorhabditis elegans Hypothetical... 29 3.7 U53155-4|AAC48265.1| 619|Caenorhabditis elegans Hypothetical pr... 28 4.9 AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical ... 28 6.5 >U41994-2|AAO38634.1| 154|Caenorhabditis elegans Rnase h protein 1.0, isoform b protein. Length = 154 Score = 31.9 bits (69), Expect = 0.40 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 2/98 (2%) Frame = +2 Query: 86 FKTKDVDAVFVE--RQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEF 259 F+T++ +V+ + KKV S F + + D YY + + + V +TN V+E Sbjct: 37 FETEEEAQKYVDDRKPKKVESTFPE----STHDTYYAVARGHSVGV----FTNYNEVKEH 88 Query: 260 LKLYRIGYLPKYYEFSIFYQKLREEAIALFHLFYYAKD 373 +K Y P + ++S EEAIA FH +Y K+ Sbjct: 89 IKNYP---QPLHKKWSTL-----EEAIAYFHKYYEGKE 118 >U41994-1|AAO91711.1| 155|Caenorhabditis elegans Rnase h protein 1.0, isoform a protein. Length = 155 Score = 31.9 bits (69), Expect = 0.40 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 2/98 (2%) Frame = +2 Query: 86 FKTKDVDAVFVE--RQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEF 259 F+T++ +V+ + KKV S F + + D YY + + + V +TN V+E Sbjct: 37 FETEEEAQKYVDDRKPKKVESTFPE----STHDTYYAVARGHSVGV----FTNYNEVKEH 88 Query: 260 LKLYRIGYLPKYYEFSIFYQKLREEAIALFHLFYYAKD 373 +K Y P + ++S EEAIA FH +Y K+ Sbjct: 89 IKNYP---QPLHKKWSTL-----EEAIAYFHKYYEGKE 118 >AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of efl-1 mutant phenotypeprotein 1 protein. Length = 4177 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = +2 Query: 140 SLFQDVDQVNVDDEYYKIGKDYDVEANIDNY----TNKKAVEEFLKLYR--IGYLPKY 295 S+ DV ++++DD+Y+ +G +D + D + AV F L+R +LP Y Sbjct: 2542 SMEDDVQRLDLDDDYFDMGGPFDAQRMDDMIFPPSFGRPAVTSFADLFRDDFDFLPPY 2599 >Z35663-8|CAA84728.1| 249|Caenorhabditis elegans Hypothetical protein T04A8.9 protein. Length = 249 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 131 KVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEF 259 KVL L Q Q ++ YYK+ K + + N N ++A ++F Sbjct: 27 KVLGLAQSASQKDIKSAYYKLSKQHHPDTNPTN--KEEAAKKF 67 >AL132865-13|CAB60609.1| 496|Caenorhabditis elegans Hypothetical protein Y62E10A.16 protein. Length = 496 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 333 RLLLFSTCSTMLKTLKPSTRVPLSLV 410 R+ F TCS +KT+K +PLS+V Sbjct: 290 RIEQFLTCSETIKTVKSDALIPLSIV 315 >U53155-4|AAC48265.1| 619|Caenorhabditis elegans Hypothetical protein ZC513.3 protein. Length = 619 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 308 WRTHSTWEDN-RFCTISRILQQLSYWCSYRC 219 WRT + E + +F +SRIL+Q + W S C Sbjct: 542 WRTFAIREKSEKFPNVSRILRQKTSWVSKNC 572 >AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical protein F37B4.7 protein. Length = 424 Score = 27.9 bits (59), Expect = 6.5 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 308 IFYQKLREEAIALFHLFYYAKDFETFYKSA-AFARVHLNEGQFLYAYYIA 454 +FY IA F + Y K +T YKSA AF R L G+FL AY +A Sbjct: 101 VFYGWATATEIAYF-AYIYVKVPKTEYKSATAFTRAALLVGRFL-AYALA 148 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,011,682 Number of Sequences: 27780 Number of extensions: 280714 Number of successful extensions: 689 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -