BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N13 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 29 2.6 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 3.5 At4g22320.1 68417.m03227 expressed protein 28 6.1 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 28 6.1 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 28 6.1 At1g60250.1 68414.m06785 zinc finger (B-box type) family protein... 28 6.1 At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:4... 28 6.1 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 8.0 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 8.0 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 29.1 bits (62), Expect = 2.6 Identities = 25/108 (23%), Positives = 46/108 (42%), Gaps = 2/108 (1%) Frame = +2 Query: 119 ERQKKVLSLFQD--VDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPK 292 E+ +K+L+ Q +DQ+ D+ K+G Y EA IDN ++ + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 293 YYEFSIFYQKLREEAIALFHLFYYAKDFETFYKSAAFARVHLNEGQFL 436 EF +F Q + +F +F ++ F + + + L E +L Sbjct: 142 ALEFRLFRQHGFNVSEDVFDVF--MENCGKFDRDDIYGLISLYEASYL 187 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 167 NVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRI 277 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 27.9 bits (59), Expect = 6.1 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 95 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEE 256 K V +E QKK ++ ++ D++ DD KI +D VE D K VEE Sbjct: 115 KYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +1 Query: 511 PQFFVNMDTLLKIYRTKMQDGILHDAKAINYGIVKEEEQYVVLR 642 P V++ TL++I R ++ +LH KA+N+ + + V+R Sbjct: 1195 PVHVVSLRTLIRIIRAAPRNLVLHLEKAVNFVLQTMDPSNTVMR 1238 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -1 Query: 406 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 260 S SG ++E +KV +++E K + + E+G++++L K DS+ F+ Sbjct: 595 SGSGQIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFE 644 >At1g60250.1 68414.m06785 zinc finger (B-box type) family protein contains similarity to zinc finger protein GI:3618320 from [Oryza sativa] Length = 251 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 16 CPSSSGAHCXSCNPXVVSXENVSLQDKRCRRSV-CGAPEKGFI 141 CP+ + C SC+ + S E+ RC+ V C P + F+ Sbjct: 161 CPTHNQILCDSCDRMIHSHEDAVPPHSRCKLCVICKRPSRRFL 203 >At1g17580.1 68414.m02165 myosin, putative similar to myosin GI:433663 from (Arabidopsis thaliana) Length = 1520 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/69 (23%), Positives = 28/69 (40%) Frame = +2 Query: 350 HLFYYAKDFETFYKSAAFARVHLNEGQFLYAYYIAVIQRNDTHGFVLPAPYEVIHNSSLI 529 H + K F+TF + FA+ L+ F ++Y + H Y V + +L Sbjct: 515 HETFSQKLFQTFKEHERFAKPKLSRTDFTISHYAGEVTYQSNHFIDKNKDYIVAEHQALF 574 Query: 530 WTLYLRFIA 556 +F+A Sbjct: 575 TASNCKFVA 583 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 301 LIVLGKITDSVQFQEFFNSFLIGVVI 224 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 301 LIVLGKITDSVQFQEFFNSFLIGVVI 224 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,061,527 Number of Sequences: 28952 Number of extensions: 256765 Number of successful extensions: 679 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -