BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N09 (475 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 28 0.83 SPAC1F7.06 |||ThiJ domain protein|Schizosaccharomyces pombe|chr ... 27 1.5 SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 27 1.9 SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pom... 26 3.4 SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 25 4.5 SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolo... 25 5.9 SPAC27E2.10c |rfc3|SPAPJ698.01c|DNA replication factor C complex... 25 5.9 SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 25 7.8 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 27.9 bits (59), Expect = 0.83 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +3 Query: 132 LSIAVAKYITISTNN*QHVITSSVLQTAWVPYLNSLG 242 LSI+ AK TI + + + S++L T+W+ +LNS+G Sbjct: 3546 LSISSAKLSTICRSVLKASVNSALL-TSWICFLNSIG 3581 >SPAC1F7.06 |||ThiJ domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 251 Score = 27.1 bits (57), Expect = 1.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 272 LMTSYYFPFAQRPDNYNLHSVKNYEAIRFLD 364 L+ SYY PF DN ++ V YEA + + Sbjct: 20 LLNSYYGPFYDDGDNTGVNVVDLYEAFKVFE 50 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 26.6 bits (56), Expect = 1.9 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 353 RFLDIFEKTFVQSLQKGKFESYG-KKID-FHD*KA 451 +FL+I+ +T + L G E G KK++ +HD KA Sbjct: 606 QFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKA 640 >SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 204 Score = 25.8 bits (54), Expect = 3.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 218 GSIPEFSWYSPIKTGYYPLMTSYYFPFAQRP 310 G P+ +Y P + YYP +Y P +P Sbjct: 107 GGYPQQPYYYPNQPNYYPAQPAYAQPVYAQP 137 >SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 25.4 bits (53), Expect = 4.5 Identities = 17/57 (29%), Positives = 23/57 (40%) Frame = +2 Query: 161 NFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRPDNYNLHS 331 NFY + YF T G+ S+P F + YP S Y P P ++ S Sbjct: 126 NFYPPIQNSTYFINATGGIDSMPYFG-LNNAPGNIYPF--SMYKPLEADPQYLSVPS 179 >SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 25.0 bits (52), Expect = 5.9 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +2 Query: 92 HLPFWWSSERYGNLKHRRGEI-YYNFYQQLTTRYYFERLTNGLGSIPEFSWYSP 250 H FWWS + NL E+ NF L FE N + EFS SP Sbjct: 118 HQKFWWSLRKKRNLPKENSELDLSNFQDDLD----FE---NSISQKNEFSQKSP 164 >SPAC27E2.10c |rfc3|SPAPJ698.01c|DNA replication factor C complex subunit Rfc3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 25.0 bits (52), Expect = 5.9 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = -1 Query: 310 RPLSEWEIV*SHQGIVTSLNR-----RVPREFRYGTQAVCKTLEVITC 182 RP + ++V SH+ I+++L + RVP YG KT ++ C Sbjct: 30 RPANLEDVV-SHKDIISTLEKFISSNRVPHMLFYGPPGTGKTSTILAC 76 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 24.6 bits (51), Expect = 7.8 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +2 Query: 17 NNEEQRLTYLTEDIGFNSYYYYFHSHL 97 + + Q++ Y+ ++ NSY Y HSH+ Sbjct: 313 SRKTQKIHYINDNDPSNSYSSYQHSHV 339 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,925,622 Number of Sequences: 5004 Number of extensions: 39115 Number of successful extensions: 122 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -