SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0005_N08
         (244 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U87223-1|AAB48481.1| 1384|Homo sapiens contactin associated prot...    31   0.90 

>U87223-1|AAB48481.1| 1384|Homo sapiens contactin associated protein
           protein.
          Length = 1384

 Score = 30.7 bits (66), Expect = 0.90
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%)
 Frame = +3

Query: 42  YGQLLAAPC--TVRCSPRTCLHQGRIIFSW 125
           Y ++L   C  T RCSP  C H GR   SW
Sbjct: 530 YAEVLFDTCGITDRCSPNMCEHDGRCYQSW 559


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,278,471
Number of Sequences: 237096
Number of extensions: 694835
Number of successful extensions: 1337
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1290
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1337
length of database: 76,859,062
effective HSP length: 58
effective length of database: 63,107,494
effective search space used: 1388364868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -