BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_N06 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6783| Best HMM Match : Porphobil_deamC (HMM E-Value=5.8) 140 8e-34 SB_20385| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_23832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5360| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23022| Best HMM Match : CUB (HMM E-Value=0) 29 2.1 SB_36985| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_9495| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) 29 3.7 SB_6508| Best HMM Match : AMP-binding (HMM E-Value=2.8026e-45) 29 3.7 SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) 29 3.7 SB_3165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_41190| Best HMM Match : Extensin_2 (HMM E-Value=0.0029) 29 3.7 SB_16962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_14110| Best HMM Match : DUF858 (HMM E-Value=2) 28 6.5 SB_29100| Best HMM Match : TPMT (HMM E-Value=5.4e-33) 27 8.6 >SB_6783| Best HMM Match : Porphobil_deamC (HMM E-Value=5.8) Length = 382 Score = 140 bits (339), Expect = 8e-34 Identities = 59/115 (51%), Positives = 84/115 (73%) Frame = +3 Query: 33 IMSADQVFHSRSEGIPSEGVKDQYADGKAARAWNKFIGDSNERTQNYKDFLIGLLKKHGC 212 +MS D V+ +RS G+P+ G+ DQYADGKAA+ W +IG +RT++Y++F LL++ Sbjct: 148 VMSMDGVYRTRSLGVPATGIPDQYADGKAAKVWQHYIGGHKKRTESYREFFCNLLRERNI 207 Query: 213 KKVLDGACGTGIDSMMLVDEGFNLVSVDASDKMLKHALKARWEKRKNPKYDEWVI 377 VLD +CGTG+DS+ML++ GF + SVDASDKMLK AL+ RW +RK +D+W I Sbjct: 208 HNVLDVSCGTGVDSIMLLENGFCVTSVDASDKMLKDALRIRWNRRKEEPFDKWGI 262 >SB_20385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 32.7 bits (71), Expect = 0.23 Identities = 40/152 (26%), Positives = 63/152 (41%), Gaps = 3/152 (1%) Frame = +3 Query: 138 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSMMLVDEGFNLV--SVDASDKM 311 F D T+ + + L +K K +L+ CG G L++EG+N + D S + Sbjct: 411 FFKDRRWTTREFTELLNVEDEKLNEKVLLEAGCGVGNLINPLLEEGYNFYFHACDFSPRA 470 Query: 312 LKHALKARWEKRKNPKYDEWVIEEANWETLPRDIENFYHGASFDAVICLGNSFAHLLDEY 491 + +++P YDE + + D+ S D + F L + Sbjct: 471 VNFV-------KESPFYDEAKVNAFQCDLTKDDLLENIPACSVDIATLI---FV-LSAIH 519 Query: 492 EDQRIQKMCLKNFAKCLKPGGLLFI-DHRNYD 584 D+ I L N K LKPGGLL + D+ YD Sbjct: 520 PDKMI--TALLNIFKVLKPGGLLLLRDYGLYD 549 >SB_23832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 29.9 bits (64), Expect = 1.6 Identities = 30/112 (26%), Positives = 49/112 (43%) Frame = +3 Query: 66 SEGIPSEGVKDQYADGKAARAWNKFIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTG 245 S I EG+ + A R W+ + + +R YK + + +GC VLD G+G Sbjct: 117 SSTIAREGL-ESVASALVER-WHFRMLNDRQRNLAYKKAISNAVS-NGCDIVLDIGSGSG 173 Query: 246 IDSMMLVDEGFNLVSVDASDKMLKHALKARWEKRKNPKYDEWVIEEANWETL 401 I SM V G V + +++K + +++N D+ IE E L Sbjct: 174 ILSMFAVQAGAKKVYACFNVRIVK-VIGGEQLEQENTHLDQEAIEPYTTECL 224 >SB_5360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/63 (23%), Positives = 30/63 (47%) Frame = -1 Query: 457 RQMTASNEAPW*KFSMSRGNVSQLASSITHSSYFGFFLFSHLALSACFNILSEASTETRL 278 R+ A W ++++ GN++ L + H +++ +FL + +LS A ET Sbjct: 401 RRSPTQEAADWIEYTLRHGNLTHLRPASVHLTWYQYFLLDVMLFMGVV-LLSVAMRETSP 459 Query: 277 KPS 269 P+ Sbjct: 460 PPT 462 >SB_23022| Best HMM Match : CUB (HMM E-Value=0) Length = 1307 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +1 Query: 298 LLTKC*STRSKPGGRRGKTQNMMNG*SKRLIGKRYRATSRTFTMALRSMRSSALEIPSPI 477 L+T+ ST PG ++ ++ +++ S ++ +RATS + S+ +S +PS Sbjct: 937 LITRLISTSIVPGVKQTSSKLLVSSHSTPILTSIHRATSTRNVLEPSSIMTSTSILPSTS 996 Query: 478 SW 483 SW Sbjct: 997 SW 998 >SB_36985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 406 ATSRTFTMALRSMRSSALEIPSPISWTSTKISG 504 A +R A MR +IPS I+W T++SG Sbjct: 118 AAARNVIQADAMMRKPGFKIPSIINWHGTRVSG 150 >SB_9495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 399 LPRDIENFYHGASFDAVICLGNSFAHLLDEYEDQRIQKM 515 LP D+ENF HG+ + V+ + SF+ +D+ + ++ Sbjct: 411 LPADLENFMHGSGDEGVVLV--SFSTYMDDMNQNVLDRL 447 >SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) Length = 908 Score = 28.7 bits (61), Expect = 3.7 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 9/72 (12%) Frame = -1 Query: 316 FNILSEASTETRLKPSSTSIMESIPVPQAPSSTFL-----HPCFF--KSPMRKSL*FCVL 158 F L +T PS+T + +IP PQ P T L HP F P + SL F + Sbjct: 684 FRTLENLATLRYFGPSNTLLHFAIPHPQIPHYTSLFRTLKHPTTFPYSGPSKTSLHFAIS 743 Query: 157 SLLSP--MNLFH 128 +P +LFH Sbjct: 744 DPRTPYYTSLFH 755 >SB_6508| Best HMM Match : AMP-binding (HMM E-Value=2.8026e-45) Length = 1038 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -1 Query: 388 LASSITHSSYFGFFLFSHLALSACFNILSEASTETRLKPSST 263 LA S T+ + HLA S+ + L+++ST RL SST Sbjct: 808 LADSSTYEHLADSCTYEHLADSSTYEHLADSSTYARLADSST 849 >SB_4910| Best HMM Match : HECT (HMM E-Value=5.8e-33) Length = 958 Score = 28.7 bits (61), Expect = 3.7 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 9/72 (12%) Frame = -1 Query: 316 FNILSEASTETRLKPSSTSIMESIPVPQAPSSTFL-----HPCFF--KSPMRKSL*FCVL 158 F L +T PS+T + +IP PQ P T L HP F P + SL F + Sbjct: 633 FRTLENLATLRYFGPSNTLLHFAIPHPQIPHYTSLFRTLKHPTTFPYSGPSKTSLHFAIS 692 Query: 157 SLLSP--MNLFH 128 +P +LFH Sbjct: 693 DPRTPYYTSLFH 704 >SB_3165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1183 Score = 28.7 bits (61), Expect = 3.7 Identities = 21/82 (25%), Positives = 36/82 (43%) Frame = -1 Query: 400 NVSQLASSITHSSYFGFFLFSHLALSACFNILSEASTETRLKPSSTSIMESIPVPQAPSS 221 +++ AS + +S+ F F+ F I AST + P+S + S+ P +P+S Sbjct: 655 SLTSFASFTSFTSFTSFASFTSFTSFTSFAIALLASTASPASPASLASPASLASPASPAS 714 Query: 220 TFLHPCFFKSPMRKSL*FCVLS 155 P SP + F + S Sbjct: 715 -LASPASLASPASTTTAFYLAS 735 >SB_41190| Best HMM Match : Extensin_2 (HMM E-Value=0.0029) Length = 476 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/87 (21%), Positives = 40/87 (45%) Frame = -3 Query: 377 DYPFIIFWVFPLLPPGFERVLQHFVRSVN*NKIETFVYQHHGVNPCSASTVQHFLASVFF 198 D P ++ + +PP R ++ V N I F+Y +HGV ++ + HF+ + + Sbjct: 292 DIPHFMY-TYHGVPPNDIRHFRYTYHGVPSNDIPHFMYTYHGV---PSNDIPHFMCT-YH 346 Query: 197 QKPDEEVFIILCSFITVSNEFVPRSSC 117 P ++ + ++ V + +P C Sbjct: 347 GVPSNDIPHFMYTYHGVPSNDIPHFMC 373 >SB_16962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = -1 Query: 493 SYSSKRWAKEFPRQMTASNEAPW*KFSMSRGNVSQLASSITHSSYFGFFL 344 SYS ++W KE P+ + K S S L S + YFG F+ Sbjct: 1 SYSQQKWFKEMPKPGNVQSSY---KLSGLNQGPSDLQSDALPTEYFGTFM 47 >SB_14110| Best HMM Match : DUF858 (HMM E-Value=2) Length = 207 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 216 KVLDGACGTGIDSMMLVDEGF-NLVSVDASDKMLKHALKARWEKRKNPKYDE 368 ++LD GTG+ + LV GF N+ ++D S+K + A K K Y E Sbjct: 69 RILDVGSGTGLQAEGLVKHGFTNIDALDPSEKSHEVARKKNLYKNYITDYLE 120 >SB_29100| Best HMM Match : TPMT (HMM E-Value=5.4e-33) Length = 242 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 216 KVLDGACGTGIDSMMLVDEGFNLVSVDASDKMLK 317 +VL CG +D + L D+G +V V+ + K ++ Sbjct: 55 RVLLPLCGKSLDLLWLADQGCQVVGVEGASKPIE 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,136,076 Number of Sequences: 59808 Number of extensions: 402992 Number of successful extensions: 1350 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -