BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M24 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 352 1e-97 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 48 7e-06 SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) 39 0.003 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_13788| Best HMM Match : rve (HMM E-Value=0.00016) 32 0.49 SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_19307| Best HMM Match : GTP_EFTU_D2 (HMM E-Value=0.068) 31 1.1 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 29 2.6 SB_59169| Best HMM Match : Sre (HMM E-Value=3.3) 29 2.6 SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 29 4.5 SB_11954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 29 4.5 SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) 29 4.5 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 28 6.0 SB_51982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_25301| Best HMM Match : GTP_EFTU_D2 (HMM E-Value=0.066) 28 6.0 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 28 6.0 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 28 7.9 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 28 7.9 SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) 28 7.9 SB_35682| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_34860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 28 7.9 SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) 28 7.9 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 28 7.9 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 28 7.9 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 352 bits (866), Expect = 1e-97 Identities = 160/207 (77%), Positives = 185/207 (89%) Frame = +2 Query: 2 QDVYKIGGIGTVPVGRVETGILKPGTVVVFAPANITTEVKSVEMHHEALQEAVPGDNVGF 181 QDVYKIGGIGTVPVGRVETG+LKPGTVV F+P+NITTEVKSVEMHHE+L EA+PGDNVGF Sbjct: 110 QDVYKIGGIGTVPVGRVETGVLKPGTVVTFSPSNITTEVKSVEMHHESLAEALPGDNVGF 169 Query: 182 NVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQISNGYTPVLDCHTAHIAC 361 NVKNVSVK+++RG VAGD KNNPP+ FTAQVIV+NHPG+I GY+PVLDCHTAHIAC Sbjct: 170 NVKNVSVKDIKRGNVAGDFKNNPPKPCKSFTAQVIVMNHPGEIHAGYSPVLDCHTAHIAC 229 Query: 362 KFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMR 541 KF ++ EK+DRR+GK EDNPK IK+GDAA+V ++PSKP+CVE+F EFPPLGRFAVRDM+ Sbjct: 230 KFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMCVETFTEFPPLGRFAVRDMK 289 Query: 542 QTVAVGVIKAVNFKEAGGGKVTKAAEK 622 QTVAVGVIK+V+ EA GGK TKAA K Sbjct: 290 QTVAVGVIKSVDKTEAAGGKTTKAATK 316 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 48.0 bits (109), Expect = 7e-06 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +2 Query: 386 VDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRD 535 +D++TGK + P+ IK AI L +C+E F +F +GRF +RD Sbjct: 496 IDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKFSDFQQMGRFTLRD 545 >SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) Length = 80 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +2 Query: 449 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 565 A V L S+P+CVE ++++ LGRF +R T+A GVI Sbjct: 40 AEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 78 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 34.7 bits (76), Expect = 0.069 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 4/101 (3%) Frame = +2 Query: 32 TVPVGRVETGILKPGTVVVFAPANI----TTEVKSVEMHHEALQEAVPGDNVGFNVKNVS 199 T+ V GIL G +V P T + S++ + + G + + + Sbjct: 329 TLASADVRRGILHEGDTLVVGPLCSGHFQTVRILSLKRNRAPCRVVRAGQSASAALSGIE 388 Query: 200 VKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQISNGY 322 ELRRG V D P R F A V +L HP IS + Sbjct: 389 RHELRRGMVMTDPSLEP-RACMCFWADVYLLFHPAAISKRF 428 >SB_13788| Best HMM Match : rve (HMM E-Value=0.00016) Length = 508 Score = 31.9 bits (69), Expect = 0.49 Identities = 25/80 (31%), Positives = 39/80 (48%) Frame = +3 Query: 147 YKKLYPVTMLVSTSKTYLSRNCAVVTLQEIRKTTHPGELQTSQRKSLC*ITQVKYQTDTH 326 ++ L+ VT+ VST T LS T++ R TH Q+S+ S C +Q + Q D Sbjct: 19 FQDLFSVTLEVSTL-TALSAYYEGATVERRRAHTH----QSSENLSCCRRSQEECQVDER 73 Query: 327 LYWIATQPT*PANLPKSKRK 386 L W + P + +K+K Sbjct: 74 LIWSSRCTKKPPSKEAAKKK 93 >SB_49646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 624 Score = 31.5 bits (68), Expect = 0.64 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +2 Query: 323 TPVLDCHTAHIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKPLCVE 490 TPVL TAH+ K ++ + D P ++KS ++VN V S L E Sbjct: 223 TPVLRIKTAHVTDKDNRVRSVLIIDNISQAPDTPATLKSSSDSVVNSVGSVGLVAE 278 >SB_19307| Best HMM Match : GTP_EFTU_D2 (HMM E-Value=0.068) Length = 173 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +2 Query: 11 YKIGGIGTVPVGRVETGILKPGTVVVFAPANITTEVKSVEMHHEALQEAVPGD 169 + I G GT+ G + +G + V +T +VKS++M + + +A GD Sbjct: 120 FSIRGQGTIMTGTILSGSVCVNDTVEIPSLKVTKKVKSMQMFKKPVDKASQGD 172 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 351 T*PANLPKSKRKSTVVLVNQQRTTLNPLNLVMPP 452 T PA P + RK+T Q RTT P PP Sbjct: 1459 TVPATKPPTTRKTTTATTTQGRTTRKPTTTAEPP 1492 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++VP++P CV SF EF + +RD+ Q Sbjct: 380 MSVVPAQPQCVASFPEFCAVSVSYIRDLSQ 409 >SB_59169| Best HMM Match : Sre (HMM E-Value=3.3) Length = 447 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/67 (23%), Positives = 31/67 (46%) Frame = -2 Query: 204 LTDTFLTLKPTLSPGTASCRASWCISTDLTSVVMLAGAKTTTVPGFRIPVSTLPTGTVPI 25 +T +T+ + + T+ +TD+TS+ M+ TT + + ++T T I Sbjct: 124 ITSITMTITTSTTDITSKTMIITTSTTDITSITMIITTSTTDITSITMIITTSTTDITSI 183 Query: 24 PPILYTS 4 I+ TS Sbjct: 184 TMIITTS 190 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -2 Query: 129 STDLTSVVMLAGAKTTTVPGFRIPVSTLPTGTVPIPPILYTS 4 +TD+TS+ M+ TT + + ++T T + I I+ T+ Sbjct: 234 TTDITSITMIITTSTTDITSITMIITTTTTDDISITMIIITT 275 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 129 STDLTSVVMLAGAKTTTVPGFRIPVSTLPTGTVPIPPILYTS 4 +TD+TS+ M+ TT + I +T T I I+ TS Sbjct: 8 TTDITSITMIITTSTTDITSITIITTTSTTDITSITMIITTS 49 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 129 STDLTSVVMLAGAKTTTVPGFRIPVSTLPTGTVPIPPILYTS 4 +TD+TS+ M+ TT + + ++T T I I+ TS Sbjct: 163 TTDITSITMIITTSTTDITSITMIITTSTTDITSITMIITTS 204 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 129 STDLTSVVMLAGAKTTTVPGFRIPVSTLPTGTVPIPPILYTS 4 +TD+TS+ M+ TT + + ++T T I I+ TS Sbjct: 177 TTDITSITMIITTSTTDITSITMIITTSTTDITSITMIITTS 218 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +2 Query: 350 HIACKFAEIKEKVDRRTGKSTEDNPKSIKSGDAAIVNLVPSKP 478 HIA K E+K D ++ K+ + PK++ SGD ++VP++P Sbjct: 74 HIAKKL-EVK---DSQSSKNNDLYPKTVPSGDIGTDSVVPNQP 112 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 396 VLVNQQRTTLNPLNLVMPPLSTWFPPSPCVWSPSRNSHP 512 + + +Q + P PP ++PP+P + P++ S+P Sbjct: 163 LFILRQHPSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYP 201 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 533 HARRNDRGVGIPGRTPHTGAWR--EPG*QWR 447 +A+ GV + GR P G WR PG +WR Sbjct: 19 YAKAVPSGVKLVGRNPRYGEWRHKRPGYEWR 49 >SB_11954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 5/63 (7%) Frame = +2 Query: 83 VVFAPANITTEVKSVEMHHE-ALQEAVPGDNVGFNVKNVSVKELRRGYVAGD----SKNN 247 VVF P NI+ + ++ A ++ +P + +KN + R GYV S+ N Sbjct: 14 VVFDPENISVDEGMIKFKGRLAFRQYMPAKPTKYGIKNWMAADARNGYVCNFKVHLSQEN 73 Query: 248 PPR 256 P R Sbjct: 74 PQR 76 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 460 VDNGGITRFNGFRVVLC*FTSTTVDFLFDFGKFAG 356 VDN G+ N F V++C T+D++FD + +G Sbjct: 1700 VDNAGMYAENAFTVLVC--DRNTIDYIFDEVQLSG 1732 >SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) Length = 925 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = -1 Query: 289 HNDLRCEVCSSPGWVVFRISC------NVTTAQFLDRYVFD 185 H ++C VC GW + R+ C + TT Q ++FD Sbjct: 172 HRRVKCSVCKKVGWSMDRLVCETCGLRSFTTVQAFSDWLFD 212 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 561 TPTATVCLMSRTAKRPRGGNSWKDSTHRGLEG 466 TP+ VCL+SR + PR W R + G Sbjct: 282 TPSLYVCLLSRAHRDPRLSTGWSPYEKREVRG 313 >SB_51982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +2 Query: 404 KSTEDNPKSIKSGDAAIVNLVPSKPLCVESFQEFPP--LGRFAVRDMRQ 544 KST+DN S S A V SK + V S +E PP + R V ++Q Sbjct: 57 KSTKDNGNSKGSSSRASERGVGSKQVSVSSLKEAPPRVVKRHTVSSLQQ 105 >SB_25301| Best HMM Match : GTP_EFTU_D2 (HMM E-Value=0.066) Length = 177 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/66 (22%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Frame = +2 Query: 5 DVYKIGGIGTVPVGRVETGILKPGTVVVFAPANI----TTEVKSVEMHHEALQEAVPGDN 172 D Y + G+GTV G GI++ ++ P + ++S+ ++E G Sbjct: 111 DTYSVPGVGTVISGTCMKGIIRLNDTLLLGPDPLGQFQPVAIRSIHRKRMPVKEVRGGQT 170 Query: 173 VGFNVK 190 F++K Sbjct: 171 ASFSLK 176 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 295 SPRSNIKRIHTCIGLPHSPHSLQICR 372 SP+ KR T GLP S HSL CR Sbjct: 537 SPKMKKKRPKTGEGLPGSKHSLDSCR 562 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 ++++P++P CV SF EF + +RD+ Q Sbjct: 381 MSVMPAQPQCVASFPEFCAVSVSYIRDLLQ 410 >SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 1175 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 385 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 414 >SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) Length = 549 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 389 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 418 >SB_35682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 147 YKKLYPVTMLVSTSKTYLSRNCAVVTLQEIRKTTHPGELQ 266 YKK+YP T + TS + LSR E R + PGE Q Sbjct: 132 YKKIYPSTNTLYTSLSPLSRK---PLTNECRDYSKPGEYQ 168 >SB_34860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +2 Query: 98 ANITTEVKSVEMHHEALQ-EAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPP 253 A+ TT A+Q E PG ++G + + VKEL++ AG + PP Sbjct: 49 ASATTSTTGSHQAMSAMQSEEEPGASMGHRTERLKVKELKQMKRAGLTPLRPP 101 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 1044 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1073 >SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 532 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 561 >SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2317 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = -2 Query: 201 TDTFLTLKPTLSPGTASCRASWCISTDLTSVVMLAGAKTTTVPGFRIPVSTLPTGTVPI 25 T +T T +P T + + ISTD T+V+ ++ A+TTT +ST T PI Sbjct: 1006 TSASMTKHATAAPITTNGTTAEPISTDGTTVLSMSTARTTTA-----SMSTAGTTAAPI 1059 >SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) Length = 1285 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 1111 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1140 >SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) Length = 605 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 184 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 213 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 87 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 116 >SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/67 (25%), Positives = 25/67 (37%) Frame = -2 Query: 219 PRRNSLTDTFLTLKPTLSPGTASCRASWCISTDLTSVVMLAGAKTTTVPGFRIPVSTLPT 40 P DT L L+ TL+P T + S + A +TT PG + + + Sbjct: 3479 PETTDEPDTTLALETTLAPETTMATETTVASETTVTPGSTAAPETTVAPGTTVALESTVA 3538 Query: 39 GTVPIPP 19 I P Sbjct: 3539 PETSIAP 3545 >SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 455 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 544 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 1616 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 360 QAMWAVWQSNTGVYPFDI*PG*FSTMTCAVKSA-APLGGLFFESPA 226 Q +AVW + G + + PG +ST + V+S+ A GG E+ A Sbjct: 78 QLNFAVWCATAGCFTSTLPPGGYSTSSAPVRSSIAGAGGPAMEAQA 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,817,402 Number of Sequences: 59808 Number of extensions: 574828 Number of successful extensions: 2097 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2082 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -