BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M22 (281 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X07173-1|CAA30160.1| 946|Homo sapiens trypsin inhibitor protein. 35 0.055 BC132685-1|AAI32686.1| 946|Homo sapiens inter-alpha (globulin) ... 33 0.13 AL158044-6|CAI12957.1| 946|Homo sapiens inter-alpha (globulin) ... 33 0.13 AL158044-5|CAI12958.1| 935|Homo sapiens inter-alpha (globulin) ... 33 0.13 AY358426-1|AAQ88792.1| 694|Homo sapiens LLLL311 protein. 31 0.68 AY238437-1|AAO49812.1| 942|Homo sapiens inter-alpha trypsin inh... 31 0.68 AL355374-4|CAI16363.1| 956|Homo sapiens inter-alpha (globulin) ... 31 0.68 AL355374-2|CAI16361.1| 577|Homo sapiens inter-alpha (globulin) ... 31 0.68 AL355374-1|CAI16360.1| 742|Homo sapiens inter-alpha (globulin) ... 31 0.68 AL158044-3|CAI12955.1| 956|Homo sapiens inter-alpha (globulin) ... 31 0.68 AL158044-2|CAI12954.1| 577|Homo sapiens inter-alpha (globulin) ... 31 0.68 AL158044-1|CAI12953.1| 742|Homo sapiens inter-alpha (globulin) ... 31 0.68 AK027849-1|BAB55409.1| 397|Homo sapiens protein ( Homo sapiens ... 31 0.68 AK027831-1|BAB55397.1| 397|Homo sapiens protein ( Homo sapiens ... 31 0.68 AB075833-1|BAB85539.1| 824|Homo sapiens KIAA1953 protein protein. 31 0.68 AK027375-1|BAB55070.1| 942|Homo sapiens protein ( Homo sapiens ... 31 0.90 X69532-1|CAA49279.1| 911|Homo sapiens inter-alpha-trypsin inhib... 29 2.1 X63652-1|CAA45188.1| 911|Homo sapiens inter-alpha-trypsin inhib... 29 2.1 X16260-1|CAA34346.1| 837|Homo sapiens inter-alpha-trypsin inhib... 29 2.1 BC069464-1|AAH69464.1| 911|Homo sapiens inter-alpha (globulin) ... 29 2.1 AY326450-1|AAP92403.1| 520|Homo sapiens GDPD domain containing ... 29 2.7 AY313782-1|AAQ72549.1| 623|Homo sapiens glycerophosphoryldieste... 29 2.7 BC133019-1|AAI33020.1| 1427|Homo sapiens CCDC144A protein protein. 28 6.3 AK125971-1|BAC86369.1| 483|Homo sapiens protein ( Homo sapiens ... 28 6.3 AB011137-1|BAA25491.2| 641|Homo sapiens KIAA0565 protein protein. 28 6.3 >X07173-1|CAA30160.1| 946|Homo sapiens trypsin inhibitor protein. Length = 946 Score = 34.7 bits (76), Expect = 0.055 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 8 EAMYTILNELNPGDYFSIIDLESIITV--HELSEADKEKTRYKYFYYNEIQP 157 EAM TIL++L D+FS+ID I ++L + K + + Y +IQP Sbjct: 331 EAMKTILDDLRAEDHFSVIDFNQNIRTWRNDLFQLQKHRLQIAKRYIEKIQP 382 >BC132685-1|AAI32686.1| 946|Homo sapiens inter-alpha (globulin) inhibitor H2 protein. Length = 946 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +2 Query: 8 EAMYTILNELNPGDYFSIIDLESIITV--HELSEADKEKTRYKYFYYNEIQP 157 EAM TIL++L D+FS+ID I ++L A K + Y +IQP Sbjct: 331 EAMKTILDDLRAEDHFSVIDFNQNIRTWRNDLISATKTQVADAKRYIEKIQP 382 >AL158044-6|CAI12957.1| 946|Homo sapiens inter-alpha (globulin) inhibitor H2 protein. Length = 946 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +2 Query: 8 EAMYTILNELNPGDYFSIIDLESIITV--HELSEADKEKTRYKYFYYNEIQP 157 EAM TIL++L D+FS+ID I ++L A K + Y +IQP Sbjct: 331 EAMKTILDDLRAEDHFSVIDFNQNIRTWRNDLISATKTQVADAKRYIEKIQP 382 >AL158044-5|CAI12958.1| 935|Homo sapiens inter-alpha (globulin) inhibitor H2 protein. Length = 935 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +2 Query: 8 EAMYTILNELNPGDYFSIIDLESIITV--HELSEADKEKTRYKYFYYNEIQP 157 EAM TIL++L D+FS+ID I ++L A K + Y +IQP Sbjct: 320 EAMKTILDDLRAEDHFSVIDFNQNIRTWRNDLISATKTQVADAKRYIEKIQP 371 >AY358426-1|AAQ88792.1| 694|Homo sapiens LLLL311 protein. Length = 694 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 315 KDALFTILHDLRPQDRFSIIGFSNRIKV 342 >AY238437-1|AAO49812.1| 942|Homo sapiens inter-alpha trypsin inhibitor heavy chain precursor 5 protein. Length = 942 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 315 KDALFTILHDLRPQDRFSIIGFSNRIKV 342 >AL355374-4|CAI16363.1| 956|Homo sapiens inter-alpha (globulin) inhibitor H5 protein. Length = 956 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 315 KDALFTILHDLRPQDRFSIIGFSNRIKV 342 >AL355374-2|CAI16361.1| 577|Homo sapiens inter-alpha (globulin) inhibitor H5 protein. Length = 577 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 190 KDALFTILHDLRPQDRFSIIGFSNRIKV 217 >AL355374-1|CAI16360.1| 742|Homo sapiens inter-alpha (globulin) inhibitor H5 protein. Length = 742 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 101 KDALFTILHDLRPQDRFSIIGFSNRIKV 128 >AL158044-3|CAI12955.1| 956|Homo sapiens inter-alpha (globulin) inhibitor H5 protein. Length = 956 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 315 KDALFTILHDLRPQDRFSIIGFSNRIKV 342 >AL158044-2|CAI12954.1| 577|Homo sapiens inter-alpha (globulin) inhibitor H5 protein. Length = 577 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 190 KDALFTILHDLRPQDRFSIIGFSNRIKV 217 >AL158044-1|CAI12953.1| 742|Homo sapiens inter-alpha (globulin) inhibitor H5 protein. Length = 742 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 101 KDALFTILHDLRPQDRFSIIGFSNRIKV 128 >AK027849-1|BAB55409.1| 397|Homo sapiens protein ( Homo sapiens cDNA FLJ14943 fis, clone PLACE1011371, weakly similar to INTER-ALPHA-TRYPSIN INHIBITOR HEAVY CHAIN H2 PRECURSOR. ). Length = 397 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 10 KDALFTILHDLRPQDRFSIIGFSNRIKV 37 >AK027831-1|BAB55397.1| 397|Homo sapiens protein ( Homo sapiens cDNA FLJ14925 fis, clone PLACE1008643, weakly similar to INTER-ALPHA-TRYPSIN INHIBITOR HEAVY CHAIN H2 PRECURSOR. ). Length = 397 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 10 KDALFTILHDLRPQDRFSIIGFSNRIKV 37 >AB075833-1|BAB85539.1| 824|Homo sapiens KIAA1953 protein protein. Length = 824 Score = 31.1 bits (67), Expect = 0.68 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 197 KDALFTILHDLRPQDRFSIIGFSNRIKV 224 >AK027375-1|BAB55070.1| 942|Homo sapiens protein ( Homo sapiens cDNA FLJ14469 fis, clone MAMMA1000897, weakly similar to INTER-ALPHA-TRYPSIN INHIBITOR HEAVY CHAIN H3 PRECURSOR. ). Length = 942 Score = 30.7 bits (66), Expect = 0.90 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSIIDLESIITV 88 K+A++TIL++L P D FSII + I V Sbjct: 315 KDALFTILHDLRPQDRFSIIGFPNRIKV 342 >X69532-1|CAA49279.1| 911|Homo sapiens inter-alpha-trypsin inhibitor heavy chain H1 protein. Length = 911 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSII 64 KEA+ IL ++ PGDYF ++ Sbjct: 312 KEALLKILGDMQPGDYFDLV 331 >X63652-1|CAA45188.1| 911|Homo sapiens inter-alpha-trypsin inhibitor heavy chain ITIH1 protein. Length = 911 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSII 64 KEA+ IL ++ PGDYF ++ Sbjct: 312 KEALLKILGDMQPGDYFDLV 331 >X16260-1|CAA34346.1| 837|Homo sapiens inter-alpha-trypsin inhibitor C-terminal protein. Length = 837 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSII 64 KEA+ IL ++ PGDYF ++ Sbjct: 238 KEALLKILGDMQPGDYFDLV 257 >BC069464-1|AAH69464.1| 911|Homo sapiens inter-alpha (globulin) inhibitor H1 protein. Length = 911 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 5 KEAMYTILNELNPGDYFSII 64 KEA+ IL ++ PGDYF ++ Sbjct: 312 KEALLKILGDMQPGDYFDLV 331 >AY326450-1|AAP92403.1| 520|Homo sapiens GDPD domain containing protein protein. Length = 520 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 17 YTILNELNPGDYFSIIDLESIITVHELSEADKEKTR 124 + L+ LN G +F +L + LSEADKE+ R Sbjct: 272 WDFLSTLNAGKWFVKPELRPFYNMKPLSEADKERAR 307 >AY313782-1|AAQ72549.1| 623|Homo sapiens glycerophosphoryldiester phosphodiesterase UgpQ protein. Length = 623 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 17 YTILNELNPGDYFSIIDLESIITVHELSEADKEKTR 124 + L+ LN G +F +L + LSEADKE+ R Sbjct: 272 WDFLSTLNAGKWFVKPELRPFYNMKPLSEADKERAR 307 >BC133019-1|AAI33020.1| 1427|Homo sapiens CCDC144A protein protein. Length = 1427 Score = 27.9 bits (59), Expect = 6.3 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +2 Query: 56 SIIDLESIITVHELSEADKEKT---RYKYFYYNEIQPKLDLVAPYQATPENI 202 +I DLES I+ + S+AD KT RYK Y E++ + L T E I Sbjct: 1250 TIKDLESEISRIKTSQADFNKTELERYKELYLEEVKVRESLSNELSRTNEMI 1301 >AK125971-1|BAC86369.1| 483|Homo sapiens protein ( Homo sapiens cDNA FLJ43983 fis, clone TESTI4018881. ). Length = 483 Score = 27.9 bits (59), Expect = 6.3 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +2 Query: 56 SIIDLESIITVHELSEADKEKT---RYKYFYYNEIQPKLDLVAPYQATPENI 202 +I DLES I+ + S+AD KT RYK Y E++ + L T E I Sbjct: 345 TIKDLESEISRIKTSQADFNKTELERYKELYLEEVKVRESLSNELSRTNEMI 396 >AB011137-1|BAA25491.2| 641|Homo sapiens KIAA0565 protein protein. Length = 641 Score = 27.9 bits (59), Expect = 6.3 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +2 Query: 56 SIIDLESIITVHELSEADKEKT---RYKYFYYNEIQPKLDLVAPYQATPENI 202 +I DLES I+ + S+AD KT RYK Y E++ + L T E I Sbjct: 554 TIKDLESEISRIKTSQADFNKTELERYKELYLEEVKVRESLSNELSRTNEMI 605 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,044,505 Number of Sequences: 237096 Number of extensions: 631287 Number of successful extensions: 1163 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 76,859,062 effective HSP length: 70 effective length of database: 60,262,342 effective search space used: 1386033866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -