BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M19 (553 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 32 0.011 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 24 2.9 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 24 2.9 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 24 2.9 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 24 2.9 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 24 2.9 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 24 2.9 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 24 2.9 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 24 2.9 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 24 2.9 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 24 2.9 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 24 2.9 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 24 2.9 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 24 2.9 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 24 2.9 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 24 2.9 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 24 2.9 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 24 2.9 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 24 2.9 AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical prote... 24 3.8 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 6.7 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 6.7 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 8.8 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 32.3 bits (70), Expect = 0.011 Identities = 16/70 (22%), Positives = 25/70 (35%) Frame = +2 Query: 320 VLVEFYAPWCGHCKQLVPIYDKLGEHFEXXXXXXXXXXXXTANELEHTKITSFPTIKLYT 499 V+V+F+A WCG CK + P ++ + I S PT Sbjct: 23 VVVDFFATWCGPCKVIAPKLEEFQNKYADKIVVVKVDVDECEELAAQYNIASMPTFLFIK 82 Query: 500 KDNQVRDYHG 529 + V + G Sbjct: 83 RKEVVGQFSG 92 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTLE 106 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 80 IIMFYADWCFACMKAANSFKKLIDTLE 106 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTLE 108 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 82 IIMFYADWCFACMKAANSFKKLIDTLE 108 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTLE 111 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 85 IIMFYADWCFACMKAANSFKKLIDTLE 111 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 95 IIMFYADWCFACMKAANSFKKLIDTLE 121 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTLE 123 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 97 IIMFYADWCFACMKAANSFKKLIDTLE 123 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTLE 105 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 79 IIMFYADWCFACMKAANSFKKLIDTLE 105 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 24.2 bits (50), Expect = 2.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 323 LVEFYAPWCGHCKQLVPIYDKLGEHFE 403 ++ FYA WC C + + KL + E Sbjct: 94 IIMFYADWCFACMKAANSFKKLIDTLE 120 >AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical protein protein. Length = 166 Score = 23.8 bits (49), Expect = 3.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 552 VSPASVRSPW*SRTWL 505 V PA +R PW R W+ Sbjct: 147 VRPAVIRRPWIRRPWI 162 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 6.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 268 LDGFSSPVRGQVLAQQVLFQSS 203 LDGF S R Q+ VLF S Sbjct: 254 LDGFRSGFRDQLRGADVLFMQS 275 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 6.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 268 LDGFSSPVRGQVLAQQVLFQSS 203 LDGF S R Q+ VLF S Sbjct: 254 LDGFRSGFRDQLRGADVLFMQS 275 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 8.8 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +1 Query: 334 LRPLVRPLQTVGSDLRQARRAFREGR*RHHRQDRRYGQRAGAHQDHVVPDHQTVH*RQP 510 L+P+ +PLQT+ +Q + +Q ++ Q+ HQ H HQ H QP Sbjct: 1290 LQPIQQPLQTLQHQYQQ----------QLQQQQQQQQQQQQQHQQH--QQHQLQHHHQP 1336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,269 Number of Sequences: 2352 Number of extensions: 9433 Number of successful extensions: 79 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -