BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M18 (497 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29370| Best HMM Match : fn3 (HMM E-Value=0) 27 6.5 SB_17397| Best HMM Match : RepA_N (HMM E-Value=3.8) 27 8.6 >SB_29370| Best HMM Match : fn3 (HMM E-Value=0) Length = 579 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -1 Query: 428 IYSTSKWDTPADVPWEKRKCATP*KSYTTWRLITSHVRSILSHI 297 +Y+ + D PA P+ A +S+ HVR++L H+ Sbjct: 457 VYAMTDEDVPAVAPYRVEGVAISARSFRLQWKFNDHVRNVLGHL 500 >SB_17397| Best HMM Match : RepA_N (HMM E-Value=3.8) Length = 104 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 335 GAMLYKIFRVWRIFFFPKVRRQVYPILKLNR*SCLVLIQF 454 GAM K +RV+RIF ++++++ PI NR CL L F Sbjct: 15 GAMFAKTYRVYRIFTNNELKKELGPI--SNR--CLALRLF 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,064,889 Number of Sequences: 59808 Number of extensions: 260736 Number of successful extensions: 469 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -