BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M17 (550 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 74 1e-15 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 21 8.2 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 73.7 bits (173), Expect = 1e-15 Identities = 30/89 (33%), Positives = 56/89 (62%) Frame = +1 Query: 76 DTLSIAQAVIFCNTRRKVDWLTESMHERDFTVSAMHGDMDQREREVIMRQFRTGSSRVLI 255 D+ ++ ++F ++K D++ + E ++ +++HGD QR+RE + F++G +L+ Sbjct: 447 DSGTLGGTLVFVEMKKKADFIAVFLSENNYPTTSIHGDRLQRQREEALADFKSGRMSILV 506 Query: 256 TTDLLARGIDVQQVSCVINYDLPTNRENY 342 T + ARG+D++ VS VINYDLP + Y Sbjct: 507 ATAVAARGLDIKNVSHVINYDLPKGIDEY 535 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -3 Query: 158 RSCIDSVSQSTLRRVLQKITACAIESV 78 R C+D+ QK + C I+ V Sbjct: 99 RQCVDNAKNEDKCLTAQKFSRCVIDYV 125 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,645 Number of Sequences: 438 Number of extensions: 2989 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -