BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M14 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 149 4e-38 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 27 0.51 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 26 0.90 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 26 0.90 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 6.3 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 149 bits (362), Expect = 4e-38 Identities = 66/104 (63%), Positives = 89/104 (85%) Frame = +1 Query: 217 RKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYLLPLGRKKGAKLTEAE 396 RK RIIDVVYNASNNEL+RTKTLVKNAI+V+DA+PFRQWYESHYLLPLG+K+ +L E Sbjct: 3 RKARIIDVVYNASNNELIRTKTLVKNAIIVIDASPFRQWYESHYLLPLGKKR--ELKAGE 60 Query: 397 EAIINKKRSQKTAKKYLSRQRLSKVEGGLEEQFHTGRVLACVAS 528 E +++KKR++ +KY+ RQ+ +K++ +EEQF+ GR+LAC++S Sbjct: 61 EDVLSKKRTKSNLRKYVKRQKNAKIDPAVEEQFNAGRLLACISS 104 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 26.6 bits (56), Expect = 0.51 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = -3 Query: 94 PGDLTHTSSSYEWAHVCR--P*PSSYA 20 PG T T Y WA VC P PS+ A Sbjct: 325 PGPQTQTEGFYSWAEVCAMLPNPSNTA 351 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 25.8 bits (54), Expect = 0.90 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -1 Query: 471 YLGQALPAQVLLRCLLTAFFVYDGFLSLSELGTFLPSEWQQVVAFI 334 + G ++P + LL C A F+++ ++ L E T L + V F+ Sbjct: 348 FCGDSIPQRALLSCAFGAVFIFN-YIPLQEGTTRLRYTFFYAVCFV 392 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 25.8 bits (54), Expect = 0.90 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 308 WMPHLSGSGMKATTCCHSEGRKVPS 382 W+PH+ +KAT H+ R +P+ Sbjct: 819 WVPHVKEITLKATRIVHAVNRLMPN 843 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.0 bits (47), Expect = 6.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 257 TMNWCVPKPW*RMLLSWWMPHLSGSG 334 T N K W R +LS W P+ G G Sbjct: 379 TRNTVSKKHWMRKVLSDWEPYPMGYG 404 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.132 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,334 Number of Sequences: 2352 Number of extensions: 14386 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -