BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M13 (441 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 2.6 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 2.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 4.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 4.5 S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating... 21 7.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 68 RCQRTINWSQHLCLSCTTTPRAMGRSY 148 R + T W ++ + TP AMG Y Sbjct: 496 RAKTTRGWGEYTPVVYKKTPHAMGLDY 522 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 354 IGFSMPDYVSDY 389 I FS PD VSDY Sbjct: 387 IDFSFPDSVSDY 398 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 305 DGHSKRYHPGTNNMLRPSSYSITPILVPSFVQ 210 DGH PG +LR + + P +F Q Sbjct: 68 DGHPVNDVPGVRRVLRNGTLVLLPFPAAAFRQ 99 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 305 DGHSKRYHPGTNNMLRPSSYSITPILVPSFVQ 210 DGH PG +LR + + P +F Q Sbjct: 68 DGHPVNDVPGVRRVLRNGTLVLLPFPAAAFRQ 99 >S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating peptide protein. Length = 50 Score = 20.6 bits (41), Expect = 7.9 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -2 Query: 80 FFGTANRALSCNCTRN 33 +F T ++ CNC R+ Sbjct: 20 YFVTPTMSIKCNCKRH 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,685 Number of Sequences: 438 Number of extensions: 3386 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -