BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M07 (341 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY623010-1|AAV41518.1| 94|Homo sapiens differentially placenta... 33 0.23 AY302185-1|AAP68818.1| 94|Homo sapiens replicative senescence ... 33 0.23 >AY623010-1|AAV41518.1| 94|Homo sapiens differentially placenta 1 expressed protein protein. Length = 94 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +2 Query: 23 IRTLIFFVFFFYCFTNQRLWYIKKYVYILKMYV*NPIIISLVS 151 I T++ ++FFY N + ++ ++IL ++ PI+ SL+S Sbjct: 33 IYTIVHLIYFFYTVLNTQTYFAVHDIFILFSWICFPILFSLIS 75 >AY302185-1|AAP68818.1| 94|Homo sapiens replicative senescence upregulated protein protein. Length = 94 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +2 Query: 23 IRTLIFFVFFFYCFTNQRLWYIKKYVYILKMYV*NPIIISLVS 151 I T++ ++FFY N + ++ ++IL ++ PI+ SL+S Sbjct: 33 IYTIVHLIYFFYTVLNTQTYFAVHDIFILFSWICFPILFSLIS 75 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,412,458 Number of Sequences: 237096 Number of extensions: 578197 Number of successful extensions: 987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 1910415606 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -