BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M06 (375 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56E4.03 |||aromatic aminotransferase |Schizosaccharomyces po... 29 0.24 SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 28 0.42 SPBC1773.13 |||aromatic aminotransferase |Schizosaccharomyces po... 25 2.9 SPAC6G9.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 3.9 SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pom... 25 5.1 SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 s... 25 5.1 SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosac... 25 5.1 SPAC19A8.07c |||U3 snoRNP-associated protein Imp4 |Schizosacchar... 24 6.8 SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosacch... 24 6.8 SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p... 24 9.0 SPAC4F8.03 ||SPAC644.01c|SBDS family ribosome maturation protein... 24 9.0 SPAC23C11.09 |||alanine-tRNA ligase |Schizosaccharomyces pombe|c... 24 9.0 SPBC211.04c |mcm6|mis5|MCM complex subunit Mcm6 |Schizosaccharom... 24 9.0 SPBC25B2.09c |||arginine-tRNA ligase|Schizosaccharomyces pombe|c... 24 9.0 >SPAC56E4.03 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 29.1 bits (62), Expect = 0.24 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 4/53 (7%) Frame = +2 Query: 101 VERQKKVLSLFQDVDQVNVDDE-YYKIGKD-YD--VEANIDXYTNKKAVEEFL 247 VER+K++ +L Q D + ++DE YY + D Y+ EA +TN++ V+E + Sbjct: 225 VERRKQIYTLAQKHDIIILEDEPYYYLQMDAYEGKPEAADKAFTNEQFVKELI 277 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 28.3 bits (60), Expect = 0.42 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +2 Query: 116 KVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVE 238 K L + + + YYK+ K Y +AN D K VE Sbjct: 89 KTLGVSKSASASEIKSAYYKLAKQYHPDANPDKAAQDKFVE 129 >SPBC1773.13 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 481 Score = 25.4 bits (53), Expect = 2.9 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 Query: 101 VERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEEFLK 250 + R+KK+L+L + D + V+DE Y + D +++ K FLK Sbjct: 224 LSRRKKLLALARKYDIIIVEDEPYYFLQMEDYNGSLNPAQQKCDGSTFLK 273 >SPAC6G9.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 132 Score = 25.0 bits (52), Expect = 3.9 Identities = 15/70 (21%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Frame = +2 Query: 5 VLVLAGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKV----LSLFQDVDQVNVDDEYY 172 ++ A +I +++ + +H +D V + QK+ S D D+ V DE+ Sbjct: 30 IMKFADMIKNARNNEDNEDNHHINYEDESDVGTDEQKQQEGVNSSAVSDTDESAVSDEFM 89 Query: 173 KIGKDYDVEA 202 +I +++ ++A Sbjct: 90 QIKEEFPMKA 99 >SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 470 Score = 24.6 bits (51), Expect = 5.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 101 VERQKKVLSLFQDVDQVNVDDEYY 172 +ER+KK L+L + D + V+DE Y Sbjct: 221 LERRKKFLTLAKKYDIIIVEDEPY 244 >SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 subunit Alp6|Schizosaccharomyces pombe|chr 2|||Manual Length = 821 Score = 24.6 bits (51), Expect = 5.1 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 110 QKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNK 226 Q+ + S+ D Q+++DD YKI E N D +K Sbjct: 38 QEIIHSISPDTFQLDIDDILYKIYSKIPPEENNDALFSK 76 >SPBC31F10.14c |hip3|hir3|HIRA interacting protein Hip3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1630 Score = 24.6 bits (51), Expect = 5.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 143 DQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEEFLK 250 DQ N + K+ + + E N D Y NK A++EFL+ Sbjct: 991 DQKNALEIICKVIR-FPGENNADVYFNKCAIKEFLE 1025 >SPAC19A8.07c |||U3 snoRNP-associated protein Imp4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 289 Score = 24.2 bits (50), Expect = 6.8 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = +2 Query: 134 QDVDQVNVDDEYYKIGK 184 Q+ + N+DDEY+++G+ Sbjct: 65 QEETETNLDDEYHRLGE 81 >SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1031 Score = 24.2 bits (50), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 134 QDVDQVNVDDEYYKIGKDYDVEANID 211 Q+V Q+N +DEY + + D EA ID Sbjct: 55 QNVMQMNFEDEYSEFSNE-DDEAEID 79 >SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 728 Score = 23.8 bits (49), Expect = 9.0 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 47 VVSPKTYHFKTK-DVDAVFVERQKKVLSLFQDVDQVNVD 160 V+ PKT+H+K + F + QKK+ DV D Sbjct: 234 VIEPKTFHYKNGISISMKFDKDQKKL--FINDVSTTKYD 270 >SPAC4F8.03 ||SPAC644.01c|SBDS family ribosome maturation protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 246 Score = 23.8 bits (49), Expect = 9.0 Identities = 7/20 (35%), Positives = 16/20 (80%) Frame = +2 Query: 110 QKKVLSLFQDVDQVNVDDEY 169 ++++ SL ++++ N+DDEY Sbjct: 189 RERLRSLADEIEEENIDDEY 208 >SPAC23C11.09 |||alanine-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 959 Score = 23.8 bits (49), Expect = 9.0 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 101 VERQKKVLSLFQDVDQVNVDDEYYKIGKDYD-VEANIDXYTNKKAV 235 V+ K ++ + + VNV EY+K D V A + N KA+ Sbjct: 823 VQEHVKAINAAEQKEVVNVVTEYFKENPDMSFVVAKVPISANPKAL 868 >SPBC211.04c |mcm6|mis5|MCM complex subunit Mcm6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 892 Score = 23.8 bits (49), Expect = 9.0 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +2 Query: 215 YTNKKAVEEFLKLYRIGYLPKYYEFSIFYQKLREEAIALFHLFYY 349 Y + K + + + + + +YY FS F + ++ I F YY Sbjct: 119 YVDYKHLTSYNDVLALAIVEQYYRFSPFLLRALQKLIEKFEPEYY 163 >SPBC25B2.09c |||arginine-tRNA ligase|Schizosaccharomyces pombe|chr 2|||Manual Length = 618 Score = 23.8 bits (49), Expect = 9.0 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +2 Query: 104 ERQKKVLSLFQDVDQVNVDDEYYKIG---KDYDVEANIDXYTNKKAVEEFLKL 253 E KV + F+D+ + D Y ++ +YD E+ + K V+E L Sbjct: 272 EESLKVWARFRDLSITKLKDTYDRLNIHYDEYDGESQVSLELMNKMVDELRSL 324 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,429,786 Number of Sequences: 5004 Number of extensions: 25948 Number of successful extensions: 100 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 120195862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -