BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M06 (375 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41994-2|AAO38634.1| 154|Caenorhabditis elegans Rnase h protein... 32 0.15 U41994-1|AAO91711.1| 155|Caenorhabditis elegans Rnase h protein... 32 0.15 AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of e... 30 0.62 U53155-4|AAC48265.1| 619|Caenorhabditis elegans Hypothetical pr... 29 1.4 AF016673-5|AAB66123.1| 684|Caenorhabditis elegans Hypothetical ... 29 1.4 Z35663-8|CAA84728.1| 249|Caenorhabditis elegans Hypothetical pr... 27 3.3 AF099919-4|AAC68791.1| 230|Caenorhabditis elegans Hypothetical ... 27 4.4 AF039041-8|AAB94189.2| 448|Caenorhabditis elegans Hypothetical ... 26 7.6 >U41994-2|AAO38634.1| 154|Caenorhabditis elegans Rnase h protein 1.0, isoform b protein. Length = 154 Score = 31.9 bits (69), Expect = 0.15 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 2/98 (2%) Frame = +2 Query: 71 FKTKDVDAVFVE--RQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEEF 244 F+T++ +V+ + KKV S F + + D YY + + + V +TN V+E Sbjct: 37 FETEEEAQKYVDDRKPKKVESTFPE----STHDTYYAVARGHSVGV----FTNYNEVKEH 88 Query: 245 LKLYRIGYLPKYYEFSIFYQKLREEAIALFHLFYYAKD 358 +K Y P + ++S EEAIA FH +Y K+ Sbjct: 89 IKNYP---QPLHKKWSTL-----EEAIAYFHKYYEGKE 118 >U41994-1|AAO91711.1| 155|Caenorhabditis elegans Rnase h protein 1.0, isoform a protein. Length = 155 Score = 31.9 bits (69), Expect = 0.15 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 2/98 (2%) Frame = +2 Query: 71 FKTKDVDAVFVE--RQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEEF 244 F+T++ +V+ + KKV S F + + D YY + + + V +TN V+E Sbjct: 37 FETEEEAQKYVDDRKPKKVESTFPE----STHDTYYAVARGHSVGV----FTNYNEVKEH 88 Query: 245 LKLYRIGYLPKYYEFSIFYQKLREEAIALFHLFYYAKD 358 +K Y P + ++S EEAIA FH +Y K+ Sbjct: 89 IKNYP---QPLHKKWSTL-----EEAIAYFHKYYEGKE 118 >AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of efl-1 mutant phenotypeprotein 1 protein. Length = 4177 Score = 29.9 bits (64), Expect = 0.62 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = +2 Query: 125 SLFQDVDQVNVDDEYYKIGKDYDVEANIDXY----TNKKAVEEFLKLYR--IGYLPKY 280 S+ DV ++++DD+Y+ +G +D + D + AV F L+R +LP Y Sbjct: 2542 SMEDDVQRLDLDDDYFDMGGPFDAQRMDDMIFPPSFGRPAVTSFADLFRDDFDFLPPY 2599 >U53155-4|AAC48265.1| 619|Caenorhabditis elegans Hypothetical protein ZC513.3 protein. Length = 619 Score = 28.7 bits (61), Expect = 1.4 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -2 Query: 293 WRTHSTWEDN-RFCTISRILQQLSYWCSXRC 204 WRT + E + +F +SRIL+Q + W S C Sbjct: 542 WRTFAIREKSEKFPNVSRILRQKTSWVSKNC 572 >AF016673-5|AAB66123.1| 684|Caenorhabditis elegans Hypothetical protein T06D4.4 protein. Length = 684 Score = 28.7 bits (61), Expect = 1.4 Identities = 14/51 (27%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +2 Query: 17 AGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLS---LFQDVDQVNVD 160 +GL+ +QS ++ + F K++DA+ + K+ L+ +F +D V D Sbjct: 297 SGLVRRIQSGILITNSSSFFGKNLDAIIQQTHKRTLANYLIFHFIDAVTFD 347 >Z35663-8|CAA84728.1| 249|Caenorhabditis elegans Hypothetical protein T04A8.9 protein. Length = 249 Score = 27.5 bits (58), Expect = 3.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 116 KVLSLFQDVDQVNVDDEYYKIGKDYDVEAN 205 KVL L Q Q ++ YYK+ K + + N Sbjct: 27 KVLGLAQSASQKDIKSAYYKLSKQHHPDTN 56 >AF099919-4|AAC68791.1| 230|Caenorhabditis elegans Hypothetical protein F40G9.12 protein. Length = 230 Score = 27.1 bits (57), Expect = 4.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 13 SSGAHCPRAIQCGVT 57 +SG HCPR + CG T Sbjct: 28 TSGDHCPRVLSCGHT 42 >AF039041-8|AAB94189.2| 448|Caenorhabditis elegans Hypothetical protein W03F8.2 protein. Length = 448 Score = 26.2 bits (55), Expect = 7.6 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 257 RIGYLPKYYEFSIFYQKLREEAIALFHLFYYAKDFET 367 +I +P+ +FSI +KLRE +H F+ +D +T Sbjct: 158 KISIVPEKEDFSILEKKLRE--FNFYHGFFPREDLQT 192 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,885,948 Number of Sequences: 27780 Number of extensions: 145551 Number of successful extensions: 417 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 546325158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -