BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M06 (375 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 1.3 At5g27230.1 68418.m03248 expressed protein ; expression support... 28 2.3 At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to... 28 2.3 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 3.1 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 3.1 At5g34900.1 68418.m04114 Ulp1 protease family protein contains P... 27 3.1 At4g22320.1 68417.m03227 expressed protein 27 3.1 At5g52920.1 68418.m06567 pyruvate kinase, putative similar to py... 27 4.1 At5g07940.1 68418.m00920 expressed protein 27 5.4 At4g34200.1 68417.m04854 D-3-phosphoglycerate dehydrogenase, put... 27 5.4 At1g79670.2 68414.m09292 wall-associated kinase, putative simila... 26 7.1 At1g79670.1 68414.m09291 wall-associated kinase, putative simila... 26 7.1 At5g24450.1 68418.m02882 transcription factor-related low simila... 26 9.4 At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 26 9.4 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 1.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 152 NVDDEYYKIGKDYDVEANIDXYTNKKAVEEFLKLYRI 262 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 27.9 bits (59), Expect = 2.3 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +2 Query: 86 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEEFLK 250 V A+ +E+++K L L + + E+ K KD+D+E + K+ VE+ K Sbjct: 69 VKALELEKKEKELCLIDESMKAK-QSEFEKKEKDFDLEQKAEVEKRKREVEQLEK 122 >At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 365 Score = 27.9 bits (59), Expect = 2.3 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +2 Query: 29 ALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIG 181 ++V S VV Y F V + E +KK+ F + DQ DDE YK G Sbjct: 306 SVVGSGVVIFGLYIFLLGKVRLMKEECEKKLPCRFNEDDQEEDDDEQYKKG 356 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 3.1 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 286 LIVLGKITDSVQFQEFFNSFLIGVVI 209 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 3.1 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 286 LIVLGKITDSVQFQEFFNSFLIGVVI 209 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 >At5g34900.1 68418.m04114 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At1g32840, At4g04010, At2g06430, At2g15140, At2g04980, At2g14130, At3g44500, At2g15190, At3g47260, At3g29210, At2g02210, At3g32900 Length = 767 Score = 27.5 bits (58), Expect = 3.1 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +2 Query: 116 KVLSLFQDVDQVNVDDEYYKIGKDYDVEANI-DXYTNKKAVEEFLKLYRIGYLPKYYEFS 292 K+++L DV ++ V+ IG D ++ + D +TN ++ L+L ++GY K E++ Sbjct: 287 KIVNLVNDVYEIEVNTI---IGNPEDFKSLVPDFHTNDTEFQQVLELVKMGYRLKKTEWN 343 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 27.5 bits (58), Expect = 3.1 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 80 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEE 241 K V +E QKK ++ ++ D++ DD KI +D VE D K VEE Sbjct: 115 KYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At5g52920.1 68418.m06567 pyruvate kinase, putative similar to pyruvate kinase isozyme G, chloroplast precursor [Nicotiana tabacum] SWISS-PROT:Q40546 Length = 579 Score = 27.1 bits (57), Expect = 4.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 188 YDVEANIDXYTNKKAVEEFLKLYRIGYLPKYYEFS 292 Y I +TN+K +++ L LY+ G P Y EF+ Sbjct: 496 YRPSGTIYAFTNEKKIQQRLALYQ-GVCPIYMEFT 529 >At5g07940.1 68418.m00920 expressed protein Length = 1526 Score = 26.6 bits (56), Expect = 5.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 61 NVSLQDKRCRRSVCGAPEKGFIPFP 135 N+S QDK C+ G EK F+ P Sbjct: 393 NISAQDKFCQMEDSGPAEKSFMKVP 417 >At4g34200.1 68417.m04854 D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative similar to phosphoglycerate dehydrogenase, Arabidopsis thaliana, SP:O04130 Length = 603 Score = 26.6 bits (56), Expect = 5.4 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -3 Query: 352 SIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQEFFNSFLIGVVID 206 +I Q+ S F L E GE+ V GK+ D V SF + V ++ Sbjct: 480 TITVQLSNVESKFASSLSESGEVKVEGKVKDGVPHLTKVGSFEVDVTLE 528 >At1g79670.2 68414.m09292 wall-associated kinase, putative similar to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana]; isoform contains non-consensus AT-acceptor splice site. Length = 714 Score = 26.2 bits (55), Expect = 7.1 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +2 Query: 14 LAGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEY 169 +AG +A + S+ +P YH K + + E+ + +S F +NVD + Sbjct: 490 IAGALAYLHSAASTP-VYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTH 540 >At1g79670.1 68414.m09291 wall-associated kinase, putative similar to wall-associated kinase 4 GI:3355308 from [Arabidopsis thaliana]; isoform contains non-consensus AT-acceptor splice site. Length = 751 Score = 26.2 bits (55), Expect = 7.1 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +2 Query: 14 LAGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEY 169 +AG +A + S+ +P YH K + + E+ + +S F +NVD + Sbjct: 527 IAGALAYLHSAASTP-VYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTH 577 >At5g24450.1 68418.m02882 transcription factor-related low similarity to transcription factor IIIC63 [Homo sapiens] GI:5281316 Length = 545 Score = 25.8 bits (54), Expect = 9.4 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +2 Query: 53 SPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDXY 217 S + + TKD+ ++K + D D ++DDEY + D D+ + Y Sbjct: 434 SQRNHQETTKDMKKCKNTNKEKDDDVNADEDSEDLDDEYEEAANDDDISISSHGY 488 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 25.8 bits (54), Expect = 9.4 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 2/69 (2%) Frame = +2 Query: 104 ERQKKVLSLFQD--VDQVNVDDEYYKIGKDYDVEANIDXYTNKKAVEEFLKLYRIGYLPK 277 E+ +K+L+ Q +DQ+ D+ K+G Y EA ID ++ + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 278 YYEFSIFYQ 304 EF +F Q Sbjct: 142 ALEFRLFRQ 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,439,813 Number of Sequences: 28952 Number of extensions: 134614 Number of successful extensions: 361 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 507810264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -