BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M05 (423 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_02_0034 + 5856165-5856183,5858845-5859173,5859275-5859277,585... 27 8.2 >05_02_0034 + 5856165-5856183,5858845-5859173,5859275-5859277, 5859440-5859517,5859623-5860090,5860378-5860437, 5860442-5860666,5860791-5860952,5861502-5861870, 5861950-5863390,5863598-5863701,5863744-5863779, 5863780-5863977,5864275-5864538 Length = 1251 Score = 26.6 bits (56), Expect = 8.2 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 16 VIVLKKNLKIHRRMMRLQFVMVTVILMSCSEQATTSGSSKVNINFDPDFLGEFFGKTPNG 195 V+ LK + ++H + QFV S S +A++ +S + + DP + +G G Sbjct: 899 VVTLKDSSQVHSASSQ-QFVRTGPWTQSASHEASSPSTSALKPSLDPPAMKNLYGGFTQG 957 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,288,646 Number of Sequences: 37544 Number of extensions: 104691 Number of successful extensions: 247 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 247 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -