BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M05 (423 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40067| Best HMM Match : Nop17p (HMM E-Value=1.5e-13) 31 0.52 SB_56074| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 >SB_40067| Best HMM Match : Nop17p (HMM E-Value=1.5e-13) Length = 287 Score = 30.7 bits (66), Expect = 0.52 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -2 Query: 212 SQLFCPPLGVFPKNSPKKSGSKLIFTLELPDVVACSEHDIKIT 84 SQ P V KNS + +L+ T+ELP V++ ++ D++I+ Sbjct: 241 SQEIVPVYNVAVKNSSEGRPRRLVVTVELPGVLSVADCDLEIS 283 >SB_56074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 27.1 bits (57), Expect = 6.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 87 HGHHYKL*THHSAMYFKIFF*YY 19 HGH YK+ H+ +K+F Y+ Sbjct: 284 HGHQYKVFAHYHGHQYKVFARYH 306 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 27.1 bits (57), Expect = 6.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 200 CPPLGVFPKNSPKKS 156 CPP V+ KNSP+KS Sbjct: 260 CPPTLVYDKNSPRKS 274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,682,547 Number of Sequences: 59808 Number of extensions: 123424 Number of successful extensions: 276 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -