BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M04 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 4.5 AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. 24 4.5 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.2 bits (50), Expect = 4.5 Identities = 14/67 (20%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -1 Query: 235 IVHKMVVVEF-DLPGFKFLGLRIFVVVFLGFGIPLAYVNDASDALCYERFHVQSSLQSIG 59 +V + +V EF G+ +L R ++ ++ + + DAS +CY + + + Sbjct: 588 LVFETIVYEFCQKVGWDYLTFRFWIGTWISIILVVLVAVDASALVCYITRFTEENFACLI 647 Query: 58 PAIEVYR 38 I +Y+ Sbjct: 648 AVIFIYK 654 >AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. Length = 182 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 433 TTTIVIKLNMTWGILVSSLDVHAEQLLV 350 T + I L WG++ LDVH +L+ Sbjct: 7 TASEKITLFSAWGLIRKDLDVHGRNVLL 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,909 Number of Sequences: 2352 Number of extensions: 14326 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -