BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M03 (454 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 5.0 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 22 8.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 22 8.8 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 22 8.8 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 5.0 Identities = 11/60 (18%), Positives = 23/60 (38%) Frame = +3 Query: 72 YVNGNKVKSYICQGYYGCEKCCVHLGSGCEKLKSSPFWFGSYTEVCTCTCPDGVDPYLGD 251 Y NG + + ++ + C + ++ + S C TCP+G + L + Sbjct: 122 YANGEVTTRSVGEKWFNMVNETTCMNYECLRNDANETFINSIGIQCNTTCPEGFEAQLSE 181 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 22.2 bits (45), Expect = 8.8 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = -2 Query: 426 YY*NKKKTNSLQYEKIETNEWFFLFKTSSNSHCF 325 YY N TN + + +N W + + + H F Sbjct: 325 YYENPLTTNRSAVDSLSSNLWNYTKRHLARMHAF 358 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.2 bits (45), Expect = 8.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 123 CEKCCVHLG 149 CEKC HLG Sbjct: 8 CEKCLAHLG 16 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 22.2 bits (45), Expect = 8.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 123 CEKCCVHLG 149 CEKC HLG Sbjct: 8 CEKCLAHLG 16 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,395 Number of Sequences: 2352 Number of extensions: 8367 Number of successful extensions: 26 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -