BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_M01 (545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 4.7 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 6.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 6.2 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 8.2 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 8.2 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +3 Query: 45 VVSTKYHPRYARYCSCSGCVRSTTACSFVSTR 140 V+S KY + C CS S T S R Sbjct: 318 VMSAKYRNAFKETCRCSPSNPSITRTGLSSVR 349 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 388 WPQEVTCVLELLTDSKYLMDEILNADDVLFAKSLLD 281 W + + L++L +YL + L DV LLD Sbjct: 696 WLERIQIALDVLEGIRYLHSQGLVHRDVKLKNVLLD 731 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 388 WPQEVTCVLELLTDSKYLMDEILNADDVLFAKSLLD 281 W + + L++L +YL + L DV LLD Sbjct: 734 WLERIQIALDVLEGIRYLHSQGLVHRDVKLKNVLLD 769 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 376 VTCVLELLTDSKYLMDEILNADDVLFAKSLLDE 278 +TC + L ++ L+D+ N D+ + L D+ Sbjct: 70 ITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQ 102 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 376 VTCVLELLTDSKYLMDEILNADDVLFAKSLLDE 278 +TC + L ++ L+D+ N D+ + L D+ Sbjct: 70 ITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQ 102 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,993 Number of Sequences: 438 Number of extensions: 2597 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -