Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0005_L23
         (473 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.       23   5.4  
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    22   9.5  
AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical prot...    22   9.5  

>AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein.
          Length = 1009

 Score = 23.0 bits (47), Expect = 5.4
 Identities = 11/60 (18%), Positives = 23/60 (38%)
 Frame = +1

Query: 82  YVNGNKVKSYICQGYYGCEKCCVHLGSGCEKLKSSPFWFGSYTEVCTCTCPDGVDPYLGD 261
           Y NG      + + ++        +   C +  ++  +  S    C  TCP+G +  L +
Sbjct: 122 YANGEVTTRSVGEKWFNMVNETTCMNYECLRNDANETFINSIGIQCNTTCPEGFEAQLSE 181


>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
           protein.
          Length = 1645

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 133 CEKCCVHLG 159
           CEKC  HLG
Sbjct: 8   CEKCLAHLG 16


>AJ438610-11|CAD27483.1|  765|Anopheles gambiae hypothetical protein
           protein.
          Length = 765

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 133 CEKCCVHLG 159
           CEKC  HLG
Sbjct: 8   CEKCLAHLG 16


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 474,672
Number of Sequences: 2352
Number of extensions: 9314
Number of successful extensions: 22
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 41670678
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)