BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_L18 (502 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 2.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.2 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 8.2 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 8.2 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.2 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 2.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 372 EKRASYFMTIIIQDVRFYNLDVLYSKV 292 E R +YF + +V+ Y+L +L+ KV Sbjct: 326 ELRNNYFHMDLENNVQSYSLQLLHQKV 352 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 10 VFFFFF*IAKYLINILFLKKNIHSLIHLNYDYILKLN 120 VF F + Y+I ++FL L+HL++ + K+N Sbjct: 1226 VFTFLMLNSLYVI-VIFLLTLKKDLLHLDWPFDPKVN 1261 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.2 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 10 VFFFFF*IAKYLINILFLKKNIHSLIHLNYDYILKLN 120 VF F + Y+I ++FL L+HL++ + K+N Sbjct: 1226 VFTFLMLNSLYVI-VIFLLTLKKDLLHLDWPFDPKVN 1261 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 10 VFFFFF*IAKYLINILFLK 66 V +F F + L+NI F+K Sbjct: 395 VDYFVFLLCSILVNIAFIK 413 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 332 TSGFTIWTYYIQKCAVLNIFRR 267 T+ F I+ Y I LN+F+R Sbjct: 391 TAKFPIYLYRISVETKLNVFKR 412 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 20.6 bits (41), Expect = 8.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 61 LKKNIHSLIHLNYDYILKLNHISQQNALKL 150 +K++I+SLI L+Y +N I N L L Sbjct: 26 IKQHIYSLISLSYLPGPPVNDIISGNILPL 55 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,149 Number of Sequences: 336 Number of extensions: 2158 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -