BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_L18 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|... 27 1.2 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 26 3.7 >SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 160 Score = 27.5 bits (58), Expect = 1.2 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 52 ILFLKKNIHSLIHLNYDYILK 114 +LF+KK+I+SL LN D ILK Sbjct: 100 LLFMKKDINSLQTLNPDLILK 120 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 25.8 bits (54), Expect = 3.7 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -2 Query: 387 LSKFCEKRASYF-MTIIIQDVRFYNLDVLYSKVCCLKYFSPTVN 259 +++ C+ + YF +T I +R+ + Y+ C L F + N Sbjct: 1969 MNRSCDSKCRYFLLTAIANQLRYPSSHTYYASCCFLYLFKSSSN 2012 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,859,345 Number of Sequences: 5004 Number of extensions: 34663 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -